KEGG   Brucella abortus A13334: BAA13334_I02461Help
Entry
BAA13334_I02461   CDS       T01704                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
baa  Brucella abortus A13334
Brite
Enzymes [BR:baa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BAA13334_I02461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1480513..1481181)
Genome map
AA seq 222 aa AA seqDB search
MVADFQDLRTKMVDNQIRTTDVTDLAVIDAFLTVPREAFVPASRQALAYIDEDQLLESEG
PAPRYIMEPSPFAKLVQLARVSKSDVVLDIGCASGYSAAVLSQLAGSVIGLESDSSLAAA
ATARLQEFGYDNVVIVSGELRAGYPSEAPYDVIFIEGAVDFVPDVLFNQLKEGGRLVAVE
GRGNAGVARLYVKESGVASGRTVFNAAIKPLPGFECEEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatttccaggatcttcgcacaaagatggtcgataaccagatccgcacgacg
gacgtgactgatctggcggttatcgatgcgtttctgaccgttccgcgcgaggcattcgtt
ccggcaagccgtcaggctctggcctatatcgatgaagatcagcttctggaaagcgaaggc
ccggccccgcgttatatcatggagccttcgcccttcgccaagcttgtgcagcttgcccgt
gtcagcaagagcgatgtcgttctcgatatcggctgcgcatccggctattcggcggctgtc
ctttcccaattggctggatcggtcatcggtttggaaagcgattcctcgcttgcagccgcc
gcaacggcgcgtcttcaggaattcggttatgacaacgttgtgatcgtttcgggcgagttg
agggcaggctatccgtccgaagcaccctatgatgttattttcatcgaaggtgcagttgat
ttcgtcccggacgttctgttcaatcagctcaaggaaggcggtcgcctggttgcggtcgaa
ggccgtggaaatgcgggcgttgcgcgtctttacgtcaaggaaagcggcgtggcttccggg
cgtaccgttttcaatgcagcgatcaaaccgctccccggtttcgagtgtgaagagcagttc
gaattttaa

DBGET integrated database retrieval system