KEGG   Brucella abortus A13334: BAA13334_I02555Help
Entry
BAA13334_I02555   CDS       T01704                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
baa  Brucella abortus A13334
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1535852..1536451)
Genome map
AA seq 199 aa AA seqDB search
MRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRTAPLDCGEYMEGIDDQARVISALK
LEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKLCDHALQQFVSLKRENIMVKHTDG
RHGMPGGPFDRIVIWLACDEVPRHFVELLATHSVLIAPIGPGDGRQIMTRISKVGSRFEQ
EDLMPVRYQPFIEGTSSVL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagcaacgccgcgc
cagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaaccgcgccgctt
gattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttccgccctgaag
cttgagcccggccatcgggttctggaaatcggcaccggctccggctttaccgccgccgtt
atgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactctgcgaccac
gctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacatacagacggg
cgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgcatgcgatgag
gtgccgcgccatttcgttgaactgctcgccacccatagcgtcctgatagccccgatcggc
cctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgttttgaacag
gaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttccgttctttag

DBGET integrated database retrieval system