KEGG   Brucella abortus A13334: BAA13334_I02756Help
Entry
BAA13334_I02756   CDS       T01704                                 

Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
baa  Brucella abortus A13334
Pathway
baa00860  Porphyrin and chlorophyll metabolism
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAA13334_I02756
Enzymes [BR:baa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BAA13334_I02756
Exosome [BR:baa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA13334_I02756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEW18087
Position
1:1650172..1651209
Genome map
AA seq 345 aa AA seqDB search
MTDRQSKYLPANISQHVDDVTGSRRLRRMRKADWSRRLVQENHLTVNDLILSFFLTYGSG
VTEPVEAMPGVERYSVDMAVRMAEKAARLGIPAIAPFPREKPEVKTDDGSFVANPDNLIN
RAVRAIKKEVPEIGIITDAALDPFTTHGHDGILRDGEILNDESVAMVVRGALSQAEAGAD
IIAPSDMMDGRVGAVRQALDEHGFSHVPIMSYATKFASAFYGPYRGAIGTQGLLKGDKKT
YYIDPANPEEAVREAEQDIAEGADMLMVKPGLPYLDIIHRLKDEFRLPTFAYQVSGEYAM
IKAAGINGWIDEEKVMMESLLAFKRAGCDGILTYFAMEVAEKLKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgtcagtccaaatatctgccagccaatatcagccagcacgtcgatgacgta
acgggcagccgccgcctgcgccgcatgcgcaaggccgactggtcgcgcaggctggtgcag
gaaaaccacctgacggtgaacgacctcattctttccttcttcctgacctatggctccggc
gtgaccgagccggtggaagcaatgcccggcgtggaacgttattcggtggatatggccgtg
cgcatggctgaaaaagccgccaggcttggcattccagccatcgcccccttcccgcgcgaa
aagccggaagtgaaaaccgacgacggctccttcgtcgcaaacccggataacctcatcaac
cgtgcggtacgcgccatcaagaaagaagtgccggaaatcggcatcatcaccgatgccgcg
ctggaccccttcaccacacatggccatgacggcattttgcgcgacggagaaattctcaac
gacgaatcggtcgccatggtggtgcgcggcgcgctttcccaggccgaggccggtgcagac
atcatcgccccgtccgacatgatggatggccgtgtgggcgctgtccgccaggcactggac
gagcacggcttcagccatgtgccgatcatgtcctatgcgaccaagttcgcctctgccttt
tacggcccctatcgcggcgccatcggcacgcaaggcctgctgaaaggcgacaagaaaacc
tattacatcgatccggccaaccctgaagaagctgttcgcgaagccgaacaggacattgcc
gagggcgccgacatgctgatggtgaaaccgggcctgccctatctcgatatcatccaccgt
ctgaaggacgaattccgcctgccgaccttcgcctatcaggtatccggcgaatatgcgatg
ataaaggctgccgggatcaatggctggatcgacgaggaaaaggtgatgatggaaagcctg
ctcgccttcaagcgcgcaggctgtgacggaattctgacctatttcgcaatggaagtggct
gaaaagctcaaggcctga

DBGET integrated database retrieval system