KEGG   Brucella abortus A13334: BAA13334_I02827Help
Entry
BAA13334_I02827   CDS       T01704                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
baa  Brucella abortus A13334
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:baa00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:baa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1699794..1700411
Genome map
AA seq 205 aa AA seqDB search
MKRNRVVIFISGGGSNMEALIRAAQAPGFPAEIVAVFSDKAEAGGLAKAEAAGIATQVFK
RKDFASKEAHEDAILAALDVLKPDIICLAGYMRLLSGRFIAPYEGRILNIHPSLLPLFPG
LHTHQRALDAGMKLAGCTVHLVTEGMDEGPILAQAAVPVLDGDTAETLAARVLKAEHRLY
PLALQKFAAGEKASNQFSDGMVLSA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaccgggtcgtcatctttatttcaggcggcggctccaacatggaagcgctg
atccgcgcggcacaagcgcccggttttccggcggaaatcgtagcggtcttttccgacaag
gcagaagcgggcggccttgccaaggcagaagcggcaggcattgccacgcaggttttcaag
cgcaaggactttgcttccaaagaagcgcatgaggatgcgatccttgccgctctcgacgtt
ctcaagccggatattatctgccttgcaggctatatgcgccttctgtcaggccgctttatt
gccccttacgaggggcgcattcttaatatccacccttccctgctaccgctttttccgggc
ctgcacacgcaccagcgcgcgctcgatgcgggcatgaagcttgcgggctgcaccgtccat
ctggtgacggaaggcatggacgaagggccaatcctcgcacaagccgcagtgccggtgctg
gacggcgatacagccgaaacgctggccgcgcgcgtgctgaaggccgaacaccggctttat
ccgcttgcgcttcaaaagtttgcggctggagagaaggcttccaaccagttttcggacggc
atggtgctcagcgcctga

DBGET integrated database retrieval system