KEGG   Brucella abortus A13334: BAA13334_II00014Help
Entry
BAA13334_II00014  CDS       T01704                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baa  Brucella abortus A13334
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:baa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:baa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:baa00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:8651..9937
Genome map
AA seq 428 aa AA seqDB search
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVGFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaattctatatccaaaagtcagtctggaaaccaattccggaacgatttcg
cgttggcacgtccaggatggtgacgcggtcgaacagggccagatcctgttcgagatagac
aatgacaagacagtcgtggaggttgatgcgccgcatgccggaacggtaaagatactgaaa
tcttccaccaccgatgaaatcgaggtcggccagagcgtcgccagcctgtttgccaaggga
gaaacgatcaccgcgcctcccgcaccggccgcagcgcaaaatgcatcggcgccaaaaacg
gcggatatattggcggtcgtcaataaaggtcaaaatggcagggccattgcgacacctctt
gccaggcgcctggccaatgatgccgggatcgaccttgaccggatcggcggcaccggccca
ggcgggcgcatccagaagaaggatgtcattgcagcattgcaaagctgcccatccattccc
gaaaccattgctgcttcgaggcaggcgcggccggaaggcgattgcctgcttaatgccgtg
tggctgcgcaagggcgaagggacgccgcttgtgctgttgcacggctttgcctcggaccac
aacaactggcgggggctttttgccggcacacaatggcaacagcccttgctggcgattgat
ctgccctcccatggcgcttccccgctcgtcgccgtcacgagccttgatgcgattgccgcg
atgatcgaggccacactcaaggccctcgatatccagcgtgcgatccttgtgggccattcc
tttggcgcagccgtcagtgctcgccttgccaatcgcggcaatatcgacatccgcgccttg
ggcctgttttcgccagccgggctcggtccggaaatcaatgtcgggttcgtccagaacttc
gttcgggcaagggcgagggaaagtgtgaccccgtggctgcacgagcttgtgcacgacaag
gccagcatttccgatactttcatcaaggccgtcgtgcagcagcgccaggataacgatctg
agcgacgccatgatggcattttccgaacatttcttcgccgacggcacgcagaccgtctcc
attctcgacgatctcgcctcgctcgaaattcccgtccgcgtcatttacggcaggcaggac
aggatattgccgttccgctacacccggaacctgcccgacaatgtcgcgctgtatgcgttc
gatgcttgcgggcacatgccgcatctggaaaagcgcggcctgagcctgcgcatcctggcg
gaggtttccgcctccgcggcaggctga

DBGET integrated database retrieval system