KEGG   Brucella abortus A13334: BAA13334_II00014Help
Entry
BAA13334_II00014  CDS       T01704                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baa  Brucella abortus A13334
Pathway
baa00010  Glycolysis / Gluconeogenesis
baa00020  Citrate cycle (TCA cycle)
baa00620  Pyruvate metabolism
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
Module
baa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA13334_II00014
   00020 Citrate cycle (TCA cycle)
    BAA13334_II00014
   00620 Pyruvate metabolism
    BAA13334_II00014
Enzymes [BR:baa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAA13334_II00014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Biotin_lipoyl Abhydrolase_1 E3_binding Biotin_lipoyl_2 Hydrolase_4 RnfC_N HlyD_3 Thioesterase Ser_hydrolase Ndr NQRA HlyD_D23 UPF0227 DUF1100 PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: AEW18567
Position
2:8651..9937
Genome map
AA seq 428 aa AA seqDB search
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVGFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaattctatatccaaaagtcagtctggaaaccaattccggaacgatttcg
cgttggcacgtccaggatggtgacgcggtcgaacagggccagatcctgttcgagatagac
aatgacaagacagtcgtggaggttgatgcgccgcatgccggaacggtaaagatactgaaa
tcttccaccaccgatgaaatcgaggtcggccagagcgtcgccagcctgtttgccaaggga
gaaacgatcaccgcgcctcccgcaccggccgcagcgcaaaatgcatcggcgccaaaaacg
gcggatatattggcggtcgtcaataaaggtcaaaatggcagggccattgcgacacctctt
gccaggcgcctggccaatgatgccgggatcgaccttgaccggatcggcggcaccggccca
ggcgggcgcatccagaagaaggatgtcattgcagcattgcaaagctgcccatccattccc
gaaaccattgctgcttcgaggcaggcgcggccggaaggcgattgcctgcttaatgccgtg
tggctgcgcaagggcgaagggacgccgcttgtgctgttgcacggctttgcctcggaccac
aacaactggcgggggctttttgccggcacacaatggcaacagcccttgctggcgattgat
ctgccctcccatggcgcttccccgctcgtcgccgtcacgagccttgatgcgattgccgcg
atgatcgaggccacactcaaggccctcgatatccagcgtgcgatccttgtgggccattcc
tttggcgcagccgtcagtgctcgccttgccaatcgcggcaatatcgacatccgcgccttg
ggcctgttttcgccagccgggctcggtccggaaatcaatgtcgggttcgtccagaacttc
gttcgggcaagggcgagggaaagtgtgaccccgtggctgcacgagcttgtgcacgacaag
gccagcatttccgatactttcatcaaggccgtcgtgcagcagcgccaggataacgatctg
agcgacgccatgatggcattttccgaacatttcttcgccgacggcacgcagaccgtctcc
attctcgacgatctcgcctcgctcgaaattcccgtccgcgtcatttacggcaggcaggac
aggatattgccgttccgctacacccggaacctgcccgacaatgtcgcgctgtatgcgttc
gatgcttgcgggcacatgccgcatctggaaaagcgcggcctgagcctgcgcatcctggcg
gaggtttccgcctccgcggcaggctga

DBGET integrated database retrieval system