KEGG   Brucella abortus A13334: BAA13334_II00221Help
Entry
BAA13334_II00221  CDS       T01704                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
baa  Brucella abortus A13334
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAA13334_II00221
Enzymes [BR:baa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BAA13334_II00221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:152342..153262
Genome map
AA seq 306 aa AA seqDB search
MKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGAIRFVGAV
GHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGANARWSSAD
IDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMADLIALSD
IISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLITADEVKHFTP
FKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYSSAAGAIAVTRVGAGAAAPTAREVE
ELIGRA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattttcgttttcggcagtgtgaatgtggatgtaagcgcccgaatggctgccctg
ccgcggccggggcagacggtaaacgcatccggctatggcatcgggctgggtggcaaagga
gccaatcaggcggttgcggtggcaaaacttggcggggcaatccgatttgtcggcgcggtc
ggccatgatgcctttggcgaactggccttaaagcagatgcgcgagtttgggctggatacc
ggcagcgtgcgcgtgatcgatgacgtcgatacaggcatggcgatcatccaggtggaggaa
accgggcagaacacgattgcggtctgtgctggcgccaatgcgcgctggtcgtcagccgat
attgatgcttatggcgctgatattgccaaggcaaggattacgcttttgcagcgcgaagtg
ccgcatgaagccaatctggccgttgcgaaagccgtgcgggcagcgggtggaaccgtcctg
ctcgacccggccccggtgggggatgcaagccagatggccgatcttatcgccctgagcgac
atcatttcgcccaacgagacggaagccgctgaaatcaccggcattgagccgaccgacctc
gcttcggcggaagcggcggggcgcaagcttctggagcgcggcccgaagatcgtcatcctc
aagcttggaagccgtggcgcgctgctgataacggcggatgaggtgaaacacttcacgccg
ttcaaggtaaaggtggtggatacggttgcagccggtgacagtttcaacggcggctttgcc
gttgctttctcgcaggcgcggcccttgcatgattgcgtgcggtatagttcggcggcgggc
gcgattgcggttacgcgggttggcgcaggcgctgccgcgccaaccgcgcgtgaggttgag
gaactcatcgggcgcgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system