KEGG   Brucella abortus A13334: BAA13334_II00286Help
Entry
BAA13334_II00286  CDS       T01704                                 

Definition
Alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
baa  Brucella abortus A13334
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:baa00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(192250..193245)
Genome map
AA seq 331 aa AA seqDB search
MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRGTVIVLQGRNEFIENYY
ETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDYADDLDHFLTGIVLPDCPP
PFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQKISDDNVRRITAALRWIGLG
RIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTYTDLALGGPTVRWVWSALETAWR
INQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVARTRNISLAVIDGARHEMLQEADFYR
EQVLAAFDAFIPGSSPVESMPQSLEPDLSQI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactgctttttgaaaccgatgcaaatccgatcccgagccgaataagaggcggt
cttttccatgcgccggacgggaaggccctgcgctacgccctgctgaaagccgaaagccgg
ccgtgccggggcacggtcatcgtgcttcagggccgcaacgaattcatcgaaaattattat
gaaaccatgtccgacctcgccgggcgcggttttaccgttgccaccttcgactggcgcggc
cagggcggctcgcatcgcctgctgcgcgaccgcctgcgcggctatgtgcgcagcttcaac
gattatgccgacgatctcgaccatttcctgaccggaatcgtgctgcccgactgcccgccg
ccatttttcattctcgctcactcggcaggtgcgctggtcgcgctttcctcactggaacgg
ctctcctcccgcatcacccgcatggtgctttgcgcgcccctgatggggcttggcggacag
aaaatcagcgatgacaatgtgcgccgcattaccgccgcgctgcgctggatcggcctgggg
agaatctatgcggcaggcgggcgcaccctgtcggcggcgcgcgcctttgccgacaatcca
ctgaccagtgatccgttacggttcatgcgcaatgtggaaatcacacggacttatacggac
ctcgcgcttggcggccccaccgtgcgctgggtctggagcgcactggaaaccgcatggcgc
atcaaccagccggatttttacaaaagccccatcgcgccggttctgattatcgcggctggt
gctgaccgcgttgtttcaacagcggtgatcgagcgtttcgtggcgcgcacgcgaaacatc
tcgctcgccgttattgacggtgcgcgccacgaaatgctccaggaagcagatttctaccgc
gaacaggtgctggcggctttcgacgccttcatccccggctcatcgccggtggaatccatg
ccccaaagtcttgaacccgacctctctcaaatctaa

DBGET integrated database retrieval system