KEGG   Brucella abortus A13334: BAA13334_II01163Help
Entry
BAA13334_II01163  CDS       T01704                                 

Definition
protocatechuate 3,4-dioxygenase subunit alpha
Orthology
K00448  
protocatechuate 3,4-dioxygenase, alpha subunit [EC:1.13.11.3]
Organism
baa  Brucella abortus A13334
Pathway
Benzoate degradation
Polycyclic aromatic hydrocarbon degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAA13334_II01163
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAA13334_II01163
   00624 Polycyclic aromatic hydrocarbon degradation
    BAA13334_II01163
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.3  protocatechuate 3,4-dioxygenase
     BAA13334_II01163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(739982..740599)
Genome map
AA seq 205 aa AA seqDB search
MVQPLGYLKETASQTAGPYVHIGLTPNFVGINGVFAEDLGTGPLYNDKAHGERITIKGRV
IDGMGAPLRDALVEIWQADAAGLYNSPSESRGKADPHFRGWGRCPSNMETGEFIFETIKP
GRVPFRDGRLMAPHVTLWIVARGINLGLQTRMYFSDEEAANAEDPVLARIEHRMRVPTLI
GQREGDVYHFDIHLQGEKETVFFDI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtacagccgctcggttatctcaaggagaccgcttcccagacagccggtccttacgtc
catatcggccttacgcccaatttcgtcggcattaacggagtttttgcagaagatctgggt
acaggtccgctttataacgacaaggcgcatggcgaacgcatcactatcaaggggcgcgtt
atcgacggcatgggcgcgccgctgcgcgatgcgctggtggaaatctggcaggccgatgct
gccgggctctataacagcccgagcgaaagccgtggcaaggccgatccgcattttcgtggc
tggggccgctgccccagcaatatggaaacgggcgaattcatcttcgagacgatcaagccc
ggccgcgttcccttccgggacgggcggctcatggcgccacatgtaaccttgtggatcgta
gcgcgcggcattaacctcggcctgcaaacgcggatgtatttttccgacgaagaagccgcc
aatgccgaagatccggtattggcgcgcatagagcatcgtatgcgcgtgccaaccttgatc
ggccagcgcgagggcgacgtctatcacttcgatatccaccttcagggcgaaaaagaaacg
gtctttttcgatatttaa

DBGET integrated database retrieval system