KEGG   Brucella abortus A13334: BAA13334_II01163Help
Entry
BAA13334_II01163  CDS       T01704                                 

Definition
protocatechuate 3,4-dioxygenase subunit alpha
Orthology
K00448  
protocatechuate 3,4-dioxygenase, alpha subunit [EC:1.13.11.3]
Organism
baa  Brucella abortus A13334
Pathway
Benzoate degradation
Polycyclic aromatic hydrocarbon degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:baa01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:baa00362]
Metabolism; Xenobiotics biodegradation and metabolism; Polycyclic aromatic hydrocarbon degradation [PATH:baa00624]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(739982..740599)
Genome map
AA seq 205 aa AA seqDB search
MVQPLGYLKETASQTAGPYVHIGLTPNFVGINGVFAEDLGTGPLYNDKAHGERITIKGRV
IDGMGAPLRDALVEIWQADAAGLYNSPSESRGKADPHFRGWGRCPSNMETGEFIFETIKP
GRVPFRDGRLMAPHVTLWIVARGINLGLQTRMYFSDEEAANAEDPVLARIEHRMRVPTLI
GQREGDVYHFDIHLQGEKETVFFDI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtacagccgctcggttatctcaaggagaccgcttcccagacagccggtccttacgtc
catatcggccttacgcccaatttcgtcggcattaacggagtttttgcagaagatctgggt
acaggtccgctttataacgacaaggcgcatggcgaacgcatcactatcaaggggcgcgtt
atcgacggcatgggcgcgccgctgcgcgatgcgctggtggaaatctggcaggccgatgct
gccgggctctataacagcccgagcgaaagccgtggcaaggccgatccgcattttcgtggc
tggggccgctgccccagcaatatggaaacgggcgaattcatcttcgagacgatcaagccc
ggccgcgttcccttccgggacgggcggctcatggcgccacatgtaaccttgtggatcgta
gcgcgcggcattaacctcggcctgcaaacgcggatgtatttttccgacgaagaagccgcc
aatgccgaagatccggtattggcgcgcatagagcatcgtatgcgcgtgccaaccttgatc
ggccagcgcgagggcgacgtctatcacttcgatatccaccttcagggcgaaaaagaaacg
gtctttttcgatatttaa

DBGET integrated database retrieval system