KEGG   Brucella abortus A13334: BAA13334_II01449Help
Entry
BAA13334_II01449  CDS       T01704                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
baa  Brucella abortus A13334
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:baa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:baa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:baa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:baa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:926387..927289
Genome map
AA seq 300 aa AA seqDB search
MTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRL
RVASSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPG
YRIAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTVEFEPD
GSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVPDPQRTEIVKAFVILAP
GFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQRFLLRKAEVEKQQQQN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtcccctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgcc
gaaaacacctatgacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgact
gccttccgcctgcttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttg
cgcgtggcatccagcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcc
tgtcttggcgcgccgatccacgatcattacggccagacggaactgggcatggtggtgaac
aaccatcatggattggaacatccggtgcggcagggttcggcgggctatgccatgccgggc
tacaggattgcggttctggatgaagcgggcaaagaagtcggtcccaatgaaccgggcgtt
ctggccattgatatcgacaattcgccgcttctctggttcaccggctattataaaaaggat
acgccctccatctccggcggatattatcgcaccggcgatacggtggaattcgagccggat
gggtctatcagcttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatc
gggcctttcgatgtggaaagcgcgcttctggaacatcctgcggtcaacgaggctgcggtg
gtcggcgttcccgatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggccccc
ggcttcgagggtacgccggaactggcggaagaactggcgcttcacgtcaagaaacagctt
tccgcccatgcctatccgcggcagatcgactttgtggcggagcttcccaagacgccgagc
ggaaaaatacagcgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaat
tag

DBGET integrated database retrieval system