KEGG   Brucella abortus A13334: BAA13334_II01449Help
Entry
BAA13334_II01449  CDS       T01704                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
baa  Brucella abortus A13334
Pathway
baa00010  Glycolysis / Gluconeogenesis
baa00620  Pyruvate metabolism
baa00640  Propanoate metabolism
baa00680  Methane metabolism
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA13334_II01449
   00620 Pyruvate metabolism
    BAA13334_II01449
   00640 Propanoate metabolism
    BAA13334_II01449
  Energy metabolism
   00680 Methane metabolism
    BAA13334_II01449
Enzymes [BR:baa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAA13334_II01449
Lipid biosynthesis proteins [BR:baa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAA13334_II01449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW19467
Position
2:926387..927289
Genome map
AA seq 300 aa AA seqDB search
MTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRL
RVASSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPG
YRIAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTVEFEPD
GSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVPDPQRTEIVKAFVILAP
GFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQRFLLRKAEVEKQQQQN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtcccctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgcc
gaaaacacctatgacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgact
gccttccgcctgcttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttg
cgcgtggcatccagcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcc
tgtcttggcgcgccgatccacgatcattacggccagacggaactgggcatggtggtgaac
aaccatcatggattggaacatccggtgcggcagggttcggcgggctatgccatgccgggc
tacaggattgcggttctggatgaagcgggcaaagaagtcggtcccaatgaaccgggcgtt
ctggccattgatatcgacaattcgccgcttctctggttcaccggctattataaaaaggat
acgccctccatctccggcggatattatcgcaccggcgatacggtggaattcgagccggat
gggtctatcagcttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatc
gggcctttcgatgtggaaagcgcgcttctggaacatcctgcggtcaacgaggctgcggtg
gtcggcgttcccgatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggccccc
ggcttcgagggtacgccggaactggcggaagaactggcgcttcacgtcaagaaacagctt
tccgcccatgcctatccgcggcagatcgactttgtggcggagcttcccaagacgccgagc
ggaaaaatacagcgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaat
tag

DBGET integrated database retrieval system