KEGG   Brucella abortus A13334: BAA13334_II01468Help
Entry
BAA13334_II01468  CDS       T01704                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
baa  Brucella abortus A13334
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BAA13334_II01468
Enzymes [BR:baa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BAA13334_II01468
Exosome [BR:baa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA13334_II01468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:933833..934903
Genome map
AA seq 356 aa AA seqDB search
MLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDEL
LDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKST
YGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFIS
VASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESV
AYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLG
AAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgcttcggc
accatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaaccgacgcc
acgaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgatgaactg
ctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcggcggat
ttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgtagcgggc
gaccagcaggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacc
tacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaac
cggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctggaaggt
tcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcg
gtcgcatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctg
gttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatc
ttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtg
gcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggcgcaaccaat
cacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactg
gccgacattctgaacgcacccgtcgatcgcccggtttttctcgaaaccaccgtgctgggc
gccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaa
cgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcg
attgcgggctggcgggatagcgtttcacgctgcctaacacgaccgcaatag

DBGET integrated database retrieval system