KEGG   Brucella abortus A13334: BAA13334_II01566Help
Entry
BAA13334_II01566  CDS       T01704                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
baa  Brucella abortus A13334
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:baa00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baa00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:baa00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(999838..1000791)
Genome map
AA seq 317 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
IAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSEQTTNFHNRAIAWLLYSAG
TCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILVEMT
MEGLYTALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAV
ADSLGHNLYTTRGKVSS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
atcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgcccgctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tccgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggt
acttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgctt
gtaaccgcgaccgaccttgccacgatgggggcaacccttgccgccggcggtgttaatccg
atcagcgggaagcgcatggtttcggcaggcaatgttgccccaattctggtcgaaatgacc
atggaaggcctttatacggctttaggcgattgggcttatacggtcggcctacccggtaaa
agcggtgtcggtggtggcatcatggcggtagtgccgggtgagctggcaattgccgcgttt
tcaccgccgcttgatccagccggaaatagtgtgaaagcaatggctgctgttgccgcagtg
gcagattcacttggccataatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system