KEGG   Brucella abortus A13334: BAA13334_II01762Help
Entry
BAA13334_II01762  CDS       T01704                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baa  Brucella abortus A13334
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAA13334_II01762
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAA13334_II01762
Enzymes [BR:baa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAA13334_II01762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1123331..1124518
Genome map
AA seq 395 aa AA seqDB search
MTLPVNPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYA
RKSGNGPHLMFAGHTDVVPPGDEKDWKHPPFAAEIEDGVMYGRGAVDMKGGIACFVAAVA
RHIEKHGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDM
IKIGRRGSLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLE
VTTIDVGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPI
KYELTWRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEF
GLTGQTMHMVDERVALADLEGLTQIYERFIADFFG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacctgtcaatcccgtcgataatcttgccgccctcatccgctgcccatccgtc
acacccgccgaagggggggcgctgactgcactggaaaaaatgctgaagctcatgggcttt
tcagcaaaccgccccgttttcagcgatgacaacacgcccgatattgaaaatctctatgcc
cgcaaatccggcaatgggccacatctgatgttcgcaggccacaccgatgtcgtgccgccc
ggcgatgaaaaggactggaagcacccgccctttgccgcagaaatcgaggacggcgtgatg
tatggccgtggcgcggtggacatgaaaggcggcatcgcctgtttcgtggccgcggttgcc
cgccacatcgaaaagcatggcaacatcaagggcagcatttcctttctcatcaccggcgat
gaggaaggcccggccgtcaacggcacggtgaaactgctcgaatgggcaaaacaacgcggc
gaaagctgggatgcatcgatcgtcggtgaaccaaccaacccgaacgcgcttggcgacatg
atcaagatcgggcggcgcggttcgctctccggcacgattaccgttcatggcgtgcagggc
catgccgcctatccgcatctggctgaaaatccggtccgtggcatcgtcacgctggttgac
agcctgctttaccccgccttcgatgaaggcacggcaaatttccaggccagcaatctggaa
gtcaccaccattgatgtgggcaacaaggccaccaatgtcatcccgaacaaggcgaccgcc
tcgttcaacatccgcttcaatgacacatggacggccgaaagccttcaagcggaaatcatc
tcccggctggaaagggccgcgcgcgacaaccgcctgcgccaggggcgcgaaacgccgatc
aaatacgaactgacctggcgtgagcggccaagccatgtcttcctcacccatgatgaaaaa
ctgatcggcacgctcaccgcatcggtagaggccgtaaccggcaaacgcccggaactgtcc
acttcaggcggcacgtccgatgcccgcttcatcaaggattattgcccggtggtggagttt
ggccttacgggccagaccatgcatatggttgatgagcgcgtggcccttgccgacctcgaa
ggcctgacgcagatttatgaacgcttcatcgcggatttctttgggtaa

DBGET integrated database retrieval system