KEGG   Brucella abortus A13334: BAA13334_II01788Help
Entry
BAA13334_II01788  CDS       T01704                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
baa  Brucella abortus A13334
Pathway
baa00010  Glycolysis / Gluconeogenesis
baa00052  Galactose metabolism
baa00500  Starch and sucrose metabolism
baa00520  Amino sugar and nucleotide sugar metabolism
baa00521  Streptomycin biosynthesis
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
Module
baa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA13334_II01788
   00052 Galactose metabolism
    BAA13334_II01788
   00500 Starch and sucrose metabolism
    BAA13334_II01788
   00520 Amino sugar and nucleotide sugar metabolism
    BAA13334_II01788
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAA13334_II01788
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BAA13334_II01788
Enzymes [BR:baa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAA13334_II01788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEW19686
Position
2:1138559..1139590
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLFRTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRATFEDKAPHKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcggagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctgtttcgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgccgccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcaaccttcgaggacaaggccccgcacaaggcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system