KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp089Help
Entry
bbp089            CDS       T00111                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bbp089 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    bbp089 (dapE)
Enzymes [BR:bab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     bbp089 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98589..99722
Genome map
AA seq 377 aa AA seqDB search
MSSCSVVNLAKQLISIPSISPMDLGCQKLISDRLINIGFSVENMNVNQTNNMWAYKGSGT
TLAFSGHTDVVPIGNKILWNSPPFSPTVDKGVLFGRGSADMKGALAAMVIAVERFVKKQP
DHHGRIAFLITSDEESMAHDGTIKIVSNLIKRKENIDYCIIGEPSSEQKLGDVIKNGRRG
SITAYLCIYGVQGHIAYPNFSDNPIHKSISFFCTLISNCWDNGNVFFSPTSVQIYDIESK
SSSDNMVPSELTVKFNFRFSNEITSSDIKKKVELLLKHFNLKYSIEWHVSGNPFLTKVGL
LSDIVVRSVEELCHISPNLSTSGGTSDGRFIAELGSQIIELGLINKTIHKANECVEIKDL
RLLCHLYECIITKIFEK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcttgttctgttgttaatttagctaagcaattaatttctattccttcaatcagt
cctatggatttagggtgtcaaaagttaatttctgatcgattaattaatattggtttttcg
gtagaaaatatgaatgttaatcaaacaaataacatgtgggcttataaaggaagtggaacg
acattagcgttttctgggcatactgatgtggttccaatagggaacaaaattctttggaat
tccccgccttttagtcctactgttgataaaggagtattgtttggtcgtggttctgctgac
atgaaaggtgctttagcagccatggttatagctgtagaaagatttgtaaagaagcaacca
gatcatcatggtagaatagcttttttaattacttcagatgaagaatcaatggctcatgat
ggtacgataaaaatagtttctaatttaattaaacgaaaagagaatattgattattgtatt
atcggtgaaccgtctagtgaacaaaaattaggtgatgttattaaaaatggacgtcgtggt
tctattacagcatatttatgtatttatggtgttcaaggtcatattgcttatccgaatttt
tctgataatccaatacataagtctatttcgtttttttgtactttgatttctaattgttgg
gataatggtaatgtttttttttctccgactagtgttcagatttatgatattgaatctaaa
tctagtagtgataatatggtacctagtgaattaacagttaaatttaactttcgttttagt
aatgaaattacaagtagtgatattaaaaaaaaagtagaacttttattaaaacattttaat
ttgaagtattcaatagaatggcatgtgtcgggtaatccttttcttactaaagttggtttg
ttatctgatattgttgtccgttcagttgaagaattgtgccatattagtccgaatttatct
acttctggtggtacttctgatggtcgttttattgctgaattaggttctcaaattatagaa
ttaggtttaattaataaaactattcataaagcaaacgaatgtgtggagattaaagattta
agattgttatgtcatctttatgaatgtattattacaaaaatttttgaaaaatag

DBGET integrated database retrieval system