KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp257Help
Entry
bbp257            CDS       T00111                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bbp257 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bbp257 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bbp257 (trpA)
Enzymes [BR:bab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bbp257 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(294709..295518)
Genome map
AA seq 269 aa AA seqDB search
MNNRYYQLNKNLIPYKLGCYIPFVVLGDPSIEISLEIIYSLIKNGADGLELGIPFSDPLA
DGPIIQQANLRAFSANITLTKCFEMLFKIRTHNPKIPIGILIYANLIFKLGIQKFYSICS
KIDIDSVLIADVPIEESFEFEQHSIKNNIDSIFVCPPDASKNFLKKLSKHSTGYIYLLSR
SGVTGIDMKITPPLKNFVKELKKLTSIPIIQGFGISNENQIKNIILSGVSGVICGSVIIQ
IIANNLNNKKIMLKKIKKLSNRFKKATII
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgttattatcaactaaataaaaaccttataccatataaattaggatgttac
attccatttgttgtacttggtgacccttctatagaaatttcactagaaataatatattca
ctaattaaaaatggagcagatgggttagaattaggcattccattttctgatccattggca
gacggaccaataatacaacaagctaatttaagagcttttagtgctaatataacgctaacg
aaatgttttgaaatgttattcaaaatacgtacacataaccctaaaattccaataggaatc
ttaatttatgctaatttaatttttaaattaggtattcaaaaattttattcaatatgttca
aaaatagatattgattcagttttaatagcagatgtacccatagaagaatcgttcgaattt
gaacaacattctattaaaaataatatagattctatatttgtttgtcctcctgatgctagc
aaaaattttttaaaaaaattatccaaacatagcactggatatatttatttactatcacgt
tctggtgttactggaattgatatgaagattaccccaccattgaaaaactttgtaaaagaa
ttaaaaaagttaacgtcgattccaattatacaaggttttggaatttctaatgaaaatcaa
attaaaaacattattctatctggtgtatctggtgtaatatgtggatctgttatcatacaa
ataatagctaataatttaaataataaaaaaatcatgttaaaaaaaataaaaaaattatct
aaccgttttaagaaagcaacaataatttaa

DBGET integrated database retrieval system