KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp258Help
Entry
bbp258            CDS       T00111                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bbp258 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bbp258 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bbp258 (trpB)
Enzymes [BR:bab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bbp258 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(295523..296707)
Genome map
AA seq 394 aa AA seqDB search
MTLLKSYFGEFGGMYVPQILMPALYKLEIEFLKALNDLQFTNELSNLLKNYAGRPTPLTL
CKNITKNTNTKLYLKREDLLHGGAHKTNQVLGQALLAKKMSKKEIIAETGAGQHGVATAL
SCALLGLKCRIYMGFKDVIRQQQNVFRMQLMGAKVISVKNGSGTLKDACNEALRDWSENY
CTSHYMIGTAAGPHPYPTMVKKFQSIIGIETRCQILKQESCLPNIIIACIGGGSNAIGIF
SEFIKDKSVCLIGVEPAGKGIKTGKHGAPMQHGSTGIYFGMKAPVMQTSEGQIKESWSIS
AGLDFPAVGPEHAWLKHIGRATYVSITDCEAINAFKILCKLEGIIPALESSHALAYALKL
ISKDTNKKQIIIVNISGRGDKDIDTIRKIDVYKE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactttattaaaatcatattttggagaatttggtggtatgtatgttccacaaatttta
atgccagcattatataaattagaaatagaatttctaaaagcacttaatgatttacaattt
actaacgaattatccaatttattaaaaaattatgcaggaagacctactcctttaacattg
tgtaaaaatataactaaaaatacgaatacaaaattatatcttaaacgtgaagatctattg
cacggaggtgcgcataaaactaatcaagttttaggacaagcattattagctaaaaaaatg
agtaaaaaagaaattatcgctgaaactggagctggacaacatggagttgctactgcattg
tcttgtgcattacttggtttgaaatgcagaatatatatgggttttaaagacgtcattaga
caacaacaaaatgtttttcgaatgcaacttatgggagcaaaagttatatctgtaaaaaat
ggatcgggtactttaaaagatgcatgtaacgaagcgttgcgtgactggtctgaaaactat
tgtacatctcactatatgataggaacagcagccgggccacacccttaccccactatggtc
aaaaagtttcaaagtattattggaatagaaactagatgtcagatcttaaaacaagaatct
tgtttgccaaatattattattgcatgcattggaggaggatccaatgctattggaatattt
tctgaatttattaaagataaatccgtatgtttaattggtgtagaacctgcaggaaaaggt
attaaaacagggaaacatggagcacccatgcaacatggtagtacaggaatttattttgga
atgaaagctccagttatgcaaacaagtgaggggcaaataaaagaatcttggtccatttca
gcaggtttagattttcctgctgtgggtccagaacatgcatggctaaaacatattggaaga
gctacatatgtctctatcactgattgcgaggctattaatgcttttaaaattttatgtaaa
ttggaaggaattattccagctttagaatcttcacacgcattagcttatgcattaaaattg
atttctaaagatacaaacaaaaaacaaataatcatagttaatatttcaggacgaggtgat
aaagatattgatactattcgaaaaattgatgtatacaaggaataa

DBGET integrated database retrieval system