KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp281Help
Entry
bbp281            CDS       T00111                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bbp281 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bbp281 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    bbp281 (sucB)
Enzymes [BR:bab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     bbp281 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327613..328845
Genome map
AA seq 410 aa AA seqDB search
MNIINIFIPDLPESVTDATIIKWHKKKGDKVQEDTILVDIETDKVILEIPSPSDGILNSI
IADKGKIVLPGQVIGTLLKIGIKNEEKIIKTTNNVVNTDNNQNINLKLLEKTYSPTVRRL
ISMHDLRDVDIIQGTGTKNRLTRKDILNYLKNIRSNTNKKINNYDLNAYNFNTTHKNHRS
IKRVKMTRLRKKISERLLSTKNNTASLTTFNEVNMQSILNLRRKYGELFKQKHGIKLGLM
SFYVKAVIEALKIFPEINASIDNDEIIYYNYFDISIAISTPRGLVTPVLKNADLMSMAEI
EIKIKDFSEKGKNSKLTIDDLIGGNFTITNGGVFGSLFSTPLINPPQSAILGMHAIHKRP
VIVDENIEVHPMMYLALSYDHRLIDGKESVGFLLKIKEFLEDFSRIVLNI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatataattaacatttttattcccgatcttcctgaatcagttactgatgctacaatc
atcaaatggcataaaaaaaaaggagataaagttcaggaagatactattttagtagatatt
gaaactgacaaagtaatactagaaataccatcaccttccgatggaatattaaattcaatt
attgcagataaaggtaaaatagttttaccaggacaagttatagggacattgctaaaaata
ggtattaaaaatgaagaaaaaataataaaaacaactaataatgttgtaaatacggataac
aaccaaaatattaatttaaaattattagaaaaaacatatagtcctactgtgagacgtcta
atttccatgcatgatttacgcgatgttgatattatacaaggcacggggacaaaaaatagg
ttaacacgtaaagatattcttaattacttaaaaaatattcgttctaatactaataaaaaa
ataaataattatgatttaaatgcatataattttaatacgacacataaaaaccatagaagt
attaaacgtgttaaaatgacacgtttacgaaaaaaaatttcagaaagattattatcaaca
aaaaacaatacagcttcactaacaacgttcaatgaagttaatatgcaatcgatacttaat
ttaagacgcaaatacggagaattatttaaacaaaaacatggaataaaattaggattaatg
tcattttatgttaaagcagttatcgaagcgttaaaaatttttccagaaatcaatgcttct
attgataatgatgaaatcatctactataactattttgatattagcattgctatttctaca
cctagaggattagttactcctgtattaaaaaatgctgatttaatgagcatggcagaaata
gagataaaaataaaagatttttctgagaaaggaaaaaattcaaaattaactatagatgat
ttaataggaggaaattttaccatcactaatggaggagtttttggatctttattttctaca
ccattaattaatccccctcaatcagcaattttaggtatgcatgctattcataaaagacct
gtaattgtagatgaaaatatagaagtgcatcctatgatgtatttagcattatcatacgac
cataggttaattgatggaaaagaatctgtaggatttttattaaaaataaaagaattctta
gaagattttagtcgtattgtgctaaatatttaa

DBGET integrated database retrieval system