KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp283Help
Entry
bbp283            CDS       T00111                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bbp283 (gpmA)
   01230 Biosynthesis of amino acids
    bbp283 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bbp283 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    bbp283 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bbp283 (gpmA)
Enzymes [BR:bab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     bbp283 (gpmA)
Exosome [BR:bab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   bbp283 (gpmA)
  Exosomal proteins of melanoma cells
   bbp283 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330198..330896
Genome map
AA seq 232 aa AA seqDB search
MKVYKLVLMRHGESIWNELNKFTGWHDVDLSNRGVQESLKAAKLLKKHGFYFDYAYSSVL
KRSIHTLWNIIKFLDQSWIPVKKSWRLNERHYGALEGLNKDDVIQKYGNDKVQQWRRSFN
IAPPKISYLEKKKLAHDSRYNNINFDILPYCESLKLTTQRVLPYWLNEIFPRFQKNTKII
IVAHGNSLRALIKYLNNINDIDILNLNIATGFPIIYEFNSEFKPIQYYYLKQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtatataaactagttttaatgcgacatggtgaaagtatatggaacgaattaaat
aaatttactggttggcatgacgtagatttatcaaaccgcggcgttcaagaatcgttgaaa
gcagcaaaattgttaaaaaaacacggtttttatttcgattacgcatattcatcggtgctt
aaacgttcaattcatacgttatggaatattattaaatttcttgatcaatcatggattcca
gttaaaaagtcttggagattaaatgaacgtcattatggagctttagaaggactaaataaa
gatgatgtcattcaaaaatatggtaatgataaagtacagcaatggagaagaagttttaat
atcgctcctcctaaaatatcatatttagaaaaaaaaaagttagctcatgattctagatat
aataatataaattttgatatactaccttattgcgaaagtttaaaattaactacgcaaaga
gtattaccatactggcttaacgaaattttcccgcgttttcaaaaaaacacaaagattatt
atagttgcgcatggaaattccttgagagccttgattaaatatttgaataacattaatgat
atagatattttaaatttaaatattgctactggttttcctataatatatgaatttaactct
gaatttaaacccattcaatattattatttaaaacaatag

DBGET integrated database retrieval system