KEGG   Buchnera aphidicola Bp: bbp284Help
Entry
bbp284            CDS       T00111                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bab  Buchnera aphidicola Bp
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bab01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bab01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bab00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bab00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bab00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:bab00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331073..332035
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRGVVRTALSRNLEVFGIYDGYLGLYENRMILLDRYSVSD
IINKGGTFLGSARFSNFFKKDIRSIAIKNMQQRNIDFLVVIGGDGSYVGAQKLTEMGFPC
ISIPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRNCGDLTLS
AAIAGGCEFIVLPEIEFTKEELVKEIKNGIKKGKKHAIVAITEYICNVEKLAKYIQRETC
RETRATILGHIQRGGAPVVYDRILASRMGEYSVDILLQGFQGRCIGTINEKMVHHDISDA
LKNMKRPFKFDWLKTAKQLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaagaattggtgtattaacaagtgggggagatgctccagggatgaatgcagca
attagaggagtcgtaagaactgccctaagtagaaatttagaagtttttggaatatacgac
ggctatcttggattatatgaaaatagaatgattctgttagatagatatagcgtttctgat
ataattaacaaaggtggtacatttttaggttcagctcggttttctaatttttttaaaaaa
gatatacgatcgatagcaattaaaaatatgcaacaaagaaacattgacttcttagtagtt
attggaggtgatggttcatatgtaggtgcacaaaaattaacagaaatgggtttcccatgt
attagcataccaggaaccattgacaatgatgtagctggtacagattatactataggatat
tttacagcattagaaacagttgtagaagcaattgatagattacgagatacttcttcttct
catcaaagaatttctatagtagaagttatggggcgtaattgcggtgatttaactttatca
gcagctatagctggaggatgtgaatttatagtgttaccagaaattgaattcactaaagaa
gaattagtaaaggaaataaaaaatggtataaaaaaaggaaaaaaacatgctattgtggct
attacagaatacatttgtaacgttgaaaaattagccaaatatattcaacgagaaacatgt
cgtgaaactagagcaacaattttaggacatatacaaagaggtggggctccagtagtttat
gatcgtattttggcatccagaatgggagagtactctgtagatatattattacagggattt
cagggccgatgcataggtacgattaatgaaaaaatggtacaccatgatatttcagatgca
ctcaaaaatatgaaaagaccatttaaatttgattggttaaagactgctaaacagttatac
taa

DBGET integrated database retrieval system