KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp284Help
Entry
bbp284            CDS       T00111                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bbp284 (pfkA)
   01230 Biosynthesis of amino acids
    bbp284 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bbp284 (pfkA)
   00030 Pentose phosphate pathway
    bbp284 (pfkA)
   00051 Fructose and mannose metabolism
    bbp284 (pfkA)
   00052 Galactose metabolism
    bbp284 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    bbp284 (pfkA)
Enzymes [BR:bab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     bbp284 (pfkA)
Protein phosphatases and associated proteins [BR:bab01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     bbp284 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331073..332035
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRGVVRTALSRNLEVFGIYDGYLGLYENRMILLDRYSVSD
IINKGGTFLGSARFSNFFKKDIRSIAIKNMQQRNIDFLVVIGGDGSYVGAQKLTEMGFPC
ISIPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRNCGDLTLS
AAIAGGCEFIVLPEIEFTKEELVKEIKNGIKKGKKHAIVAITEYICNVEKLAKYIQRETC
RETRATILGHIQRGGAPVVYDRILASRMGEYSVDILLQGFQGRCIGTINEKMVHHDISDA
LKNMKRPFKFDWLKTAKQLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaagaattggtgtattaacaagtgggggagatgctccagggatgaatgcagca
attagaggagtcgtaagaactgccctaagtagaaatttagaagtttttggaatatacgac
ggctatcttggattatatgaaaatagaatgattctgttagatagatatagcgtttctgat
ataattaacaaaggtggtacatttttaggttcagctcggttttctaatttttttaaaaaa
gatatacgatcgatagcaattaaaaatatgcaacaaagaaacattgacttcttagtagtt
attggaggtgatggttcatatgtaggtgcacaaaaattaacagaaatgggtttcccatgt
attagcataccaggaaccattgacaatgatgtagctggtacagattatactataggatat
tttacagcattagaaacagttgtagaagcaattgatagattacgagatacttcttcttct
catcaaagaatttctatagtagaagttatggggcgtaattgcggtgatttaactttatca
gcagctatagctggaggatgtgaatttatagtgttaccagaaattgaattcactaaagaa
gaattagtaaaggaaataaaaaatggtataaaaaaaggaaaaaaacatgctattgtggct
attacagaatacatttgtaacgttgaaaaattagccaaatatattcaacgagaaacatgt
cgtgaaactagagcaacaattttaggacatatacaaagaggtggggctccagtagtttat
gatcgtattttggcatccagaatgggagagtactctgtagatatattattacagggattt
cagggccgatgcataggtacgattaatgaaaaaatggtacaccatgatatttcagatgca
ctcaaaaatatgaaaagaccatttaaatttgattggttaaagactgctaaacagttatac
taa

DBGET integrated database retrieval system