KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_499Help
Entry
bbp_499           CDS       T00111                                 

Gene name
yggH
Definition
(GenBank) hypothetical methyltransferase
  KO
K03439  
tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Brite
Enzymes [BR:bab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     bbp_499 (yggH)
Transfer RNA biogenesis [BR:bab03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    bbp_499 (yggH)
 Prokaryotic Type
    bbp_499 (yggH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(561774..562502)
Genome map
AA seq 242 aa AA seqDB search
MYFYLKYNINNMIMRRVRSFVSRNRKLTQNKRQFLKNYLLKYGIDFSCSYVNFNFIFNNE
YPVILEIGFGTGEFLINMARKNLFSNFLGIEVYIPSILSCLRYIHKYNLPNVKVIFYDAV
EVISYMISNNSLSEVYILFPDPWPKRRHHKRRIITKELLEVILKKLVFGGYLNIATDCQI
YAKSILNIIENIKGYINLSNTGDYVIRSDYRLVTKFEKKGLVLGNKIFNLKFKSIFNNSN
FL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttatttaaagtataatataaataatatgataatgcgtcgagttcgtagtttt
gtatctagaaataggaagttaacacaaaataagcgtcagttcttgaaaaattatttatta
aaatatggtatagattttagttgttcatatgtaaattttaattttatttttaataatgaa
tatccagtaatattagaaattggttttggaactggtgaatttttaattaatatggctaga
aaaaatttgtttagtaattttctgggtattgaagtttatattcctagtattttgtcttgc
ttacgatatatacacaagtataatttaccaaatgtgaaagtcattttttatgatgcagta
gaagtgatttcttatatgatttcaaataatagtttatctgaagtttacattctttttcca
gatccttggcctaaaaggcgccatcataaaaggagaattattacgaaggaattattggaa
gtcatattaaaaaaattggtgtttggaggatatcttaatatagctacagattgtcaaata
tatgctaaaagtattcttaatattattgaaaatattaaaggatatataaatttatctaat
acaggagattatgttattagatcagattatcgtttagtgacaaagtttgaaaaaaaagga
cttgttttaggaaacaaaatttttaatttaaaatttaaatctatatttaataatagtaat
tttttataa

DBGET integrated database retrieval system