KEGG   Brucella abortus NCTC 10505: DO78_1630Help
Entry
DO78_1630         CDS       T03686                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00071  Fatty acid degradation
babc00072  Synthesis and degradation of ketone bodies
babc00280  Valine, leucine and isoleucine degradation
babc00310  Lysine degradation
babc00362  Benzoate degradation
babc00380  Tryptophan metabolism
babc00620  Pyruvate metabolism
babc00630  Glyoxylate and dicarboxylate metabolism
babc00640  Propanoate metabolism
babc00650  Butanoate metabolism
babc00900  Terpenoid backbone biosynthesis
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01120  Microbial metabolism in diverse environments
babc01130  Biosynthesis of antibiotics
babc01200  Carbon metabolism
babc01212  Fatty acid metabolism
babc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DO78_1630 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    DO78_1630 (phbA)
   00640 Propanoate metabolism
    DO78_1630 (phbA)
   00650 Butanoate metabolism
    DO78_1630 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    DO78_1630 (phbA)
   00072 Synthesis and degradation of ketone bodies
    DO78_1630 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DO78_1630 (phbA)
   00310 Lysine degradation
    DO78_1630 (phbA)
   00380 Tryptophan metabolism
    DO78_1630 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DO78_1630 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DO78_1630 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DO78_1630 (phbA)
Enzymes [BR:babc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DO78_1630 (phbA)
Exosome [BR:babc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DO78_1630 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ57830
UniProt: A0A2K4NLU9
Position
1:complement(1638992..1640176)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system