KEGG   Burkholderia ambifaria MC40-6: BamMC406_0028Help
Entry
BamMC406_0028     CDS       T00684                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bac  Burkholderia ambifaria MC40-6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(35356..38370)
Genome map
AA seq 1004 aa AA seqDB search
MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTAAAQGSLGFAVSEQGV
GNRLSLTDDALARNLADVQLRGGLPASGLPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLSITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASAAI
QIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARIELDVATAAGVKRQIVSATDGDDLERLTKRALYAGLRVGEVHAVKGAEY
VELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRRYDENGMPVKGDYALIFEEEYARAARVPAYRALFDGVDVALEVERAHNGYFSIDR
KGGWTDTSESSAAARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDPGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEEHQFAALPVQEGDGPAHALGIELSRVLWAHLREQGYVDAQGKVLDRLKDA
LRQSALVLPEAFETLRAPIVAMLRKLSGRFAVRNADERRAIALRRDASGKAVVFGDDFRA
LWDRIRHRTVYSVEFDNAKLVRDCTAALRDAPDIARARLQWRKAEIDIGKAGIEAVEVAG
AGTVLIDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLDDFRVNPQQFIALAADAIN
RCKRLALVAGIAYRRLGERNVHALESFESEALTGYLRNLRPDARKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVPTPLGSYHPDWAVLAEQDGGERLYFVVDTPNADGDVT
TEHERAKLACGEAHFRALVDGEDAARFVRVRQAEALFEPAVLRL
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcatttcgaagcggatctcgactaccagcgcgaggcgatcgacgccgtctgc
gacctgtttcgcggccaggaatcgtatcgcggcgacttcagcgtgctcgcgaacgccgcg
cccggcacgacggccgccgcgcaaggttcgctcggcttcgcggtgtcggagcaaggcgtc
ggcaaccggctgtcgctgaccgacgacgcgctcgcgcgcaatctcgccgacgtgcagctg
cgcggcgggctgccggcgtccggcctgcccggctcgcgcgacttcaccgtcgagatggag
accggcaccggcaagacctacgtgtacctgcgcacgatcttcgagctgaaccgccgctac
ggcttcacgaagttcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctgtcgatcaccgaggaccatttccgcgcgctgtatgcgggcgtgccgtacgactac
ttcctgtacgactccgcgaagctcggccaggtgcgccacttcgcggcgagcgcggcgatc
cagatcatggtgatgacggttgccgcgatcaacaagaaggagatcaacaacctctacaag
gacagcgagaagacgggcggcgagaagccgatcgacctgatccgcgcgacgcggccgatc
gtgatcgtcgacgagccgcagagcgtcgacggcgggctcgaggggcgcgggcgcgaagcg
ctcgccgcgatggcgccgctctgcacgctgcgctattcggcgacgcacgtcgaccgtcat
cacatggtgtaccggctcgacgcggtcgatgcgtacgagcgcaagctcgtcaagcagatc
gagatcgcgtcggcgatagtcgaggatgcgcacaacaagccgtacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagcgcgcgcatcgagctggacgtcgcgaccgcggcc
ggcgtgaagcgccagatcgtgtcggcgaccgacggcgacgatctcgagcgcctgacgaag
cgcgcactgtatgcggggctgcgcgtcggcgaagtccatgcggtgaagggcgccgagtac
gtcgagctgcgccatccggaaggcgaggcgttcctgtcgctcggcgaggcgttcggcgac
atcgacacgctcgccgtgcagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggaattgcgtctggccgagcgcggcgtgaaggtgctgtcgctgttcttcgtcgattcg
gtcgaacgctatcgccgctacgacgagaacgggatgcccgtgaagggcgactacgcgctg
atcttcgaagaggaatatgcgcgcgcggcccgcgtgccggcttaccgtgcgttgttcgac
ggcgtcgacgtcgcgctcgaggtcgagcgcgcgcacaacggctacttctcgatcgaccgc
aagggtggctggaccgacacgagcgagagcagcgccgccgcacgcgagaacgcggagcgc
gcgtacggcctcatcatgcgcgagaaggaagcgctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaacccgaacgtgttccagatc
tgcacgctgcgcgacatccagaccgagcgcgagcgtcgccagacgctcggccgcgggctg
cgcctcgccgtcgaccaggacggcgagcgcgtgcgcgacccgggcgtcaacacgctgacc
gtgatcgcgaccgagcgctacgagtcgtttgccgagaacctgcaaaaggaaatcgaggcc
gatacgggcatccgcttcgggatcgtcgaggaacaccagttcgcggcgctgccggtgcag
gaaggcgacgggcccgcgcatgcgctcggcatcgagctgtcgcgcgtgctgtgggcgcat
ctgcgcgaacagggctacgtcgacgcgcagggcaaagtgctcgaccggctgaaggacgcg
ctgcgccagagcgcactcgtgctgcccgaagcgttcgagacgctgcgcgcgccgatcgtc
gcgatgctgcgcaagctgtcgggccgcttcgccgtgcgcaatgcggacgagcggcgcgcg
atcgcgttgcggcgcgacgcgtcgggcaaggctgtcgtgttcggcgacgacttccgcgcg
ctgtgggaccgtatccgccaccgcaccgtgtacagcgtcgagttcgacaacgcgaagctc
gtgcgcgactgcacggccgcgctgcgcgacgcgccggacatcgcgcgtgcccggctgcag
tggcgcaaggccgagatcgacatcggcaaggccggcatcgaggcggtcgaggtggccggc
gcgggcacggtgctgatcgacgaaggcgagctgccgctgcccgacctgctcaccgagctg
caggaccgcacgcagctcacgcgccgctcgctcgcgacgatcctcgccgacagcggccgg
ctcgacgatttccgcgtgaatccgcagcagttcatcgcgctggccgccgatgcgatcaac
cgctgcaagcggctcgcgctggtcgcgggcatcgcgtaccgcaggctcggcgaacgcaac
gtgcatgcgctcgaatcgttcgagagcgaggcgctgaccggctatctgcgcaacctgcgt
cccgatgcgcgcaagtcgatccacgaggccgtcgtgtgcgagaccgacgcggagcgtgcg
ttcgccgatgcgctggaagcgcacgacggcgtgaagctgtacgcgaagctgcccgcgtgg
ttccgcgtgccgacgccgctcggcagctatcaccccgactgggcggtgctcgcggagcag
gatggcggcgagcggctgtatttcgtcgtcgatacgccgaatgccgatggcgacgtgacg
accgagcacgagcgcgcgaagctcgcgtgcggtgaagcgcatttccgtgcgctggtggac
ggggaagatgccgcgcgattcgtgcgcgtcaggcaggcggaggcgttgttcgagcctgct
gtgttgcggctttga

DBGET integrated database retrieval system