KEGG   Burkholderia ambifaria MC40-6: BamMC406_0221Help
Entry
BamMC406_0221     CDS       T00684                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bac01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bac00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:255635..256627
Genome map
AA seq 330 aa AA seqDB search
MTEPNASSDLQAEHSSTGVVRPIELIAAPSSLGLKPNGAGREPDTWRGPGALLATGLAAR
LGARVAWLAHPAYVFEPQPGTRIRNGVSIRAFSLELAAHVAGALARGAFPIVLGGDCSIL
LGCLLGNRHAGGRGLVHVDGHSDFFHPGNYDTATRLGSAAGMDLALATGRGEPLLTCWPD
LDGPLVDDRDACQVGERDAETAEFEAAYGDIVRTAITQTTIQQLLARGPAAVAGELVDWL
HRRALRRVWLHVDLDVLDQSQLPAVDSPGSPGLDFDGLDALLGPLVASGCVAGIDFTIYD
PGLDPGLAHADRIARSVGRSAAALPGVRSR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgaacgcttcatccgacctgcaggccgaacattcgtcaaccggcgtcgtt
cggccgatcgaactcatcgccgcgccgagcagcctcggcctgaagccgaacggcgccggc
cgcgagcccgacacgtggcgcggcccaggcgcgctgctcgccaccgggctcgccgcccgt
ctgggcgcgcgcgttgcgtggctcgcgcatcctgcctatgtgttcgagccgcaacccggc
acccgcatccgtaacggcgtgtcgatccgcgcgttctcgctcgaacttgccgcgcacgtc
gccggtgcgctcgcgcggggcgcctttccaatcgtgctcggcggcgactgcagcatcctg
ctcgggtgcctgctgggcaaccggcacgcagggggccgcgggctcgtccacgtcgacggg
cacagcgacttcttccatccgggcaattacgacacggcgacgcggctcggctccgcggcc
gggatggatctcgcgctggcgaccggccggggcgagccgctgctgacgtgctggccggac
ctggacggcccgctcgtcgacgatcgcgacgcatgccaggtcggcgagcgcgacgccgaa
accgccgagttcgaggctgcctacggcgatatcgttcgaacggcgatcacacaaacgacg
atccagcagttgctcgcgcgcgggcctgccgcggtcgctggcgaactcgtcgactggctg
cacaggcgcgcgcttcggcgggtgtggctgcacgtcgatctcgacgtgctcgatcagtcg
caacttcctgccgtggattcgcccggctcgccggggctggacttcgatgggctcgatgcg
ttgctcgggccgctcgtcgcgtccgggtgcgttgcggggatcgacttcacgatctacgac
ccggggctcgatccggggctggcgcatgcggaccggatcgcgcgcagcgtcgggcggagt
gcggctgcgctgccgggtgtgcggagccgatag

DBGET integrated database retrieval system