KEGG   Burkholderia ambifaria MC40-6: BamMC406_0455Help
Entry
BamMC406_0455     CDS       T00684                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
Enzymes [BR:bac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BamMC406_0455
Secretion system [BR:bac02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BamMC406_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:511666..512394
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEV
NLGTQIIYSDAAGDYVLLGDLVDTKTHKNLTDARLSDLNKIDFASLPLANAIKVVKGNGA
RKIAVFSDPNCPYCKRLETTLQSVDNVTVYTFLYPVLSPDSTTKSKAIWCATDRAKSWEG
WMLEHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcatcgctggcgctggccgtcacgatggcgacgcttggc
tgcaccgcgcaggccgaccagaccaccgacaagttgaaagccacgctgcaagcgcgtctg
ggcagcgacgcgccgatcaagagcgtgtcgaaatcgccggtcgcgggcctgtacgaagtc
aacctcggcacgcagatcatctatagcgatgcagccggcgactacgtgctgctcggcgat
ctcgtcgacaccaagacgcacaagaacctgaccgacgcgcgcctgtccgacctgaacaag
atcgacttcgcgagcctgccgctcgcgaacgcgatcaaggtggtcaagggcaacggcgca
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagcggctcgagacgacg
cttcagtcggtcgacaacgtgaccgtctacacgttcctgtacccggtgctgtcgcccgat
tcgaccacgaagtcgaaggcgatctggtgcgcgaccgaccgcgcgaaaagctgggagggc
tggatgctcgagcatcgcgcaccgtccggcgccggcaactgcgatacgagcgcgctcgac
aagaacctcgcgctcggccgcgggatgaacgtcacgggcacgccgacgatcttcctgccc
gacggccgtcgcctgccgggcgcggtatcggccgatcagctgaaccaggcgctcgcgtcg
agcaagtaa

DBGET integrated database retrieval system