KEGG   Burkholderia ambifaria MC40-6: BamMC406_0757Help
Entry
BamMC406_0757     CDS       T00684                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bac00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:842489..843520
Genome map
AA seq 343 aa AA seqDB search
MTTDTTGRTGNPAAAASPERFRYGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVK
VFNNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacaccactggccgcaccggcaatcccgccgcggccgcgagccccgagcgg
ttccgctacggtttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaaacac
ctgctgtcgatcgagggcctgccgcgctcgatcgtcaatcatattctcgatacggccgag
cagttcgtcagcgtgacggaccgcgaggtgaagaaggtgccgctgctgcgcggcaagtcg
gtgttcaacctgttcttcgagaattcgacgcgcacgcgcacgaccttcgagatcgccgcg
acgcgcctgtcggccgatgtcctcaacctgaacatcaacgcgtcgtcgacgagcaagggc
gagtcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtg
cgtcacgcatcgagcggcgcgccgtacctgattgccgagcactgcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgccatgcgcacccgacgcagggcctgctcgacatgtac
acgatccgccactacaagcgcgacttcacgaagctgcgcgtggcgatcgttggcgacatc
ctgcattcgcgcgtcgcgcgttccgacatccacgcgctcaccacgctcggcgtgccggaa
gtgcgcgcgatcggcccgcgcacgctgctgccgggcggtctcgagcagatgggcgtgaag
gtgttcaacaacctcgacgaagggctgaagggcgtcgacgtgatcatcatgctgcgcctg
cagaacgagcggatgagcggcgcgctgctgccgtccgcgcaggagtacttcaagacctgg
ggcctgacgcccgagcgcctcgcgctcgccgcgcccgacgcgatcgtgatgcacccgggg
ccgatgaaccgcggcgtcgagatcgactcgcaggtcgccgacggtccgcagtcggtgatc
ctcaaccaggtcacgttcggcatcgccgtgcggatggcggtgatgggcatcgttgccggc
aacagcgactga

DBGET integrated database retrieval system