KEGG   Burkholderia ambifaria MC40-6: BamMC406_0800Help
Entry
BamMC406_0800     CDS       T00684                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
Enzymes [BR:bac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BamMC406_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD MTS PrmA Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_18 Met_10 TPMT Ubie_methyltran Spermine_synth Methyltransf_32 Methyltr_RsmB-F Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ACB63296
JGI: BamMC4060800
UniProt: B1YUG9
Position
1:complement(893550..894206)
Genome map
AA seq 218 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDLDVLGLLSIVKRENYVSPEHRDLAFADLELPLPGGRGK
MLFPRVEARMLQELAVKKHENVLVIGAGSGYLAALFAHRTLHVTAVEIDPAIAKFAADNL
RNDGVTNAEVVLGDGSLGWPDKAPYDVICVAGGLPVVPQQMLEQLKIGGRLSAFVGGRPV
MKAQIITRIDDKQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacgcgcgtttcaacatgatcgaacaacagatccggccgtgggacgta
ctggatctggacgtcctgggcctgctgtcgatcgtcaagcgtgaaaactacgtgtcgccc
gaacatcgcgatctcgcgttcgccgacctcgagctgccgctgcccggcggccgcggcaag
atgctgttcccgcgcgtcgaagcgcgcatgctgcaggaactggcggtcaagaagcacgag
aacgtgctcgtgatcggcgcgggctccggctacctggccgcgctgttcgcgcatcgcacg
ctgcacgtgacggctgtcgagatcgatccggccatcgcgaagttcgcggccgacaacctg
cgcaacgacggcgtgacgaacgcggaagtcgtgctcggcgacggttcgctcggctggccc
gacaaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcag
atgctcgaacagctgaagatcggcggccgcctgtcggcgttcgtcggcggccgtccggtg
atgaaggcgcagatcatcacgcgcatcgacgacaagcagtaccgtgtcgccgacgtgttc
gagacctacgtcgaccacctcgtcaacgcgatcgaaccgtcgcgtttcaagttctga

DBGET integrated database retrieval system