KEGG   Burkholderia ambifaria MC40-6: BamMC406_0837Help
Entry
BamMC406_0837     CDS       T00684                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00052  Galactose metabolism
bac00500  Starch and sucrose metabolism
bac00520  Amino sugar and nucleotide sugar metabolism
bac00521  Streptomycin biosynthesis
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
Module
bac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_0837
   00052 Galactose metabolism
    BamMC406_0837
   00500 Starch and sucrose metabolism
    BamMC406_0837
   00520 Amino sugar and nucleotide sugar metabolism
    BamMC406_0837
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BamMC406_0837
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BamMC406_0837
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BamMC406_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 HTH_IclR LacI
Motif
Other DBs
NCBI-ProteinID: ACB63328
JGI: BamMC4060837
UniProt: B1YUK1
Position
1:complement(924274..926202)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAVQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTITDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAANVDTVEIVERAHA
GEALALEAVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLQNIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDVLAVGVAIRRAS
TNGELPETVAQARARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggctgtcgtcgcggtccagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgtttcgcgctggaaaccggcccgggcgag
atcacgcagatccgcgtctatcccggcgccgactatccaacgatcaccgacgcgatccgc
aagtatctgaaggacgtgaagatcagccgcgtgaaccacgcggcgatcgcgatcgcgaac
ccggtcgacggcgaccaggtcacgatgaccaatcacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctcgtcgtcaatgacttcaccgcgctcgcg
atggcgctgcccggcctcacggatgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcgggctgctcgggcccggcaccgggctcggcgtgtccggcctgatt
ccggccgacgatcgctggatcgcgctcggcagcgaaggcggccatgcatcgttcgcgccg
caggacgagcgcgaggatctcgtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgtgcgctcgccgcgcgc
gacaagaagcgcgtcgcagcgaacgtcgacacggtcgagatcgtcgagcgcgcccatgcg
ggcgaagcgctcgcgctcgaggccgtcgaatgcttctgcgggattctcggcgcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtctatatcggcggcggcgtcgca
ctgaagctcggcgaactgttcacccgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgtttcacgcactatctgcagaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtgtcggcgattctcgcggagcagttgtcgaaccgttcgggcggcgcgtcg
tcggcggtgttcgagcgaattcgccagatgcgcgacgcgctgacgccggcggagcgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgacccgatcgtcgacatc
gcgcgcaaggcggacgtgagccagccgacggtgattcgcttctgccgctcgcttggctgc
cagggcttgtcggacttcaagctgaagctcgcgaccggcctcaccggcacgattccgatg
agccacagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgat
aacacggtgtccgcgatcctgcagctgcgcgaacacctgaacttcgagcacgtcgagaat
gcgatcgagatactgaacggcgcgcgccgcatcgagttctacgggctcggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgaggtggcgatgcag
gccggtgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacgtcctcgcggtcggcgtcgcgatccgtcgcgcgtcg
accaacggcgagttgcccgagacggtcgcgcaggcacgcgcacgcgcgagcgacgacgaa
acggccgacgtgctcgactggctgagccacggcgcatcgccggcggcgaaggacgtcgcg
cgcgactga

DBGET integrated database retrieval system