KEGG   Burkholderia ambifaria MC40-6: BamMC406_0871Help
Entry
BamMC406_0871     CDS       T00684                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00230  Purine metabolism
bac01100  Metabolic pathways
Module
bac_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BamMC406_0871
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BamMC406_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 MMR_HSR1 RsgA_GTPase ABC_tran AAA_16 AAA_22 AAA_29 Septin AAA_25 AAA_23 GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: ACB63362
JGI: BamMC4060871
UniProt: B1YUN5
Position
1:958451..959134
Genome map
AA seq 227 aa AA seqDB search
MTEFTRDGHASHALHGGVYPGNLFMVIAPSGAGKSTLVNALLSKDSDICLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMMNGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEMAHASEAEY
VVINENFDRALAELECIVTATRLRFASQYARHTELFIELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcacccgcgacggccacgcgtcgcatgcgctgcacggcggcgtctatccc
ggcaacctgttcatggtcatcgcaccgtcgggcgccggcaagtcgacgctcgtgaacgcg
ctgctgtcgaaggacagcgacatctgcctgtcgatttcgtacacgacccgcaagccgcgc
ccgggcgagcaggacggccagcactaccacttcacgaccgtcgaggatttccgcgcgcgc
cacgccgcgcacgaattcctcgagagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtctggatcgaagagcagatgatgaacggccacgacgtgctgctcgagatcgactgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcattctgccg
ccgtcgctcgatgcgctcgaggagcgcctgaagaagcgcgggcaggacgaaccgaacgtg
atcacgcgacgcctgctcgccgcgggcagcgagatggcgcatgcatccgaggcggaatac
gtcgtgatcaacgagaatttcgatcgtgcgctggccgagctcgagtgcatcgtcacggca
acgcgcctgcgctttgcttcgcagtacgcgcgacacacggagctgttcatcgagctcggc
atccatctgccccacgcggaatga

DBGET integrated database retrieval system