KEGG   Burkholderia ambifaria MC40-6: BamMC406_1019Help
Entry
BamMC406_1019     CDS       T00684                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00520  Amino sugar and nucleotide sugar metabolism
bac01100  Metabolic pathways
bac01501  beta-Lactam resistance
Module
bac_M00628  beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BamMC406_1019
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BamMC406_1019
Enzymes [BR:bac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BamMC406_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACB63510
JGI: BamMC4061019
UniProt: B1YVM9
Position
1:1108728..1109756
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDAILEQDVAPYDWLGLSLSAVIPAHVIYTQVDKRPAGFSRVWLQDIL
RGQLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNGLKAQ
ASAESVRRLKRMRARGKSFKWDKLIVQPEYLQAQALLSSALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcgcgcgac
gatgcgcggcgccttgcccatccgaacaccggcggcgtgatcctgttcgcgcggcatttc
cagaaccgcgcgcagctgaccgcgctgaccgattcgatccgtgcggtgcgcgaggacatc
ctgatcgccgtcgatcacgaaggcggccgcgtgcagcggttccgcaccgacggcttcacg
gtgctgcccgcgatgcgccgcctcggcgaactgtgggaccgcgacgtgctgcttgcgacg
aaggtcgccaccgcggtcggctacatcctggccgccgagctgcgcgcgtgcgggatcgac
atgagcttcacgccggtgctcgacctcgattacgggcactcgaaggtgatcggcgatcgc
gcgttccatcgcgacccgcgcgtcgtcacgctgctcgcgaagagcctgaaccacgggctg
tcgctcgcgggcatggcgaactgcggcaagcatttcccggggcacggcttcgcggaagcc
gattcgcacgtcgcgctgccgaccgacgaccggccgctcgacgcgatcctcgagcaggac
gtcgcgccgtacgactggctcgggctgtcgctgtccgccgtgattcccgcgcacgtgatc
tacacgcaggtcgacaagcggcccgccggcttctcgcgcgtgtggctgcaggacatcctg
cgcgggcagttgggctttaccggcgcgatcttcagcgacgacctgtcgatggaggcggca
cgcgaaggcggcacgctcacgcaggcggccgacgcggcgctcgctgccggttgcgacatg
gtgctcgtctgcaaccagccggaggcggccgaggtcgtgttgaacggcctgaaggcgcag
gcatcggccgagtcggtgcgacgcctgaagcggatgcgtgcgcgcggcaagtcgttcaag
tgggacaagctgatcgtgcagcccgagtatctgcaggcgcaggcgctgttgagcagcgca
ctcgcgtaa

DBGET integrated database retrieval system