KEGG   Burkholderia ambifaria MC40-6: BamMC406_1019Help
Entry
BamMC406_1019     CDS       T00684                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bac00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bac00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1108728..1109756
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDAILEQDVAPYDWLGLSLSAVIPAHVIYTQVDKRPAGFSRVWLQDIL
RGQLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNGLKAQ
ASAESVRRLKRMRARGKSFKWDKLIVQPEYLQAQALLSSALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcgcgcgac
gatgcgcggcgccttgcccatccgaacaccggcggcgtgatcctgttcgcgcggcatttc
cagaaccgcgcgcagctgaccgcgctgaccgattcgatccgtgcggtgcgcgaggacatc
ctgatcgccgtcgatcacgaaggcggccgcgtgcagcggttccgcaccgacggcttcacg
gtgctgcccgcgatgcgccgcctcggcgaactgtgggaccgcgacgtgctgcttgcgacg
aaggtcgccaccgcggtcggctacatcctggccgccgagctgcgcgcgtgcgggatcgac
atgagcttcacgccggtgctcgacctcgattacgggcactcgaaggtgatcggcgatcgc
gcgttccatcgcgacccgcgcgtcgtcacgctgctcgcgaagagcctgaaccacgggctg
tcgctcgcgggcatggcgaactgcggcaagcatttcccggggcacggcttcgcggaagcc
gattcgcacgtcgcgctgccgaccgacgaccggccgctcgacgcgatcctcgagcaggac
gtcgcgccgtacgactggctcgggctgtcgctgtccgccgtgattcccgcgcacgtgatc
tacacgcaggtcgacaagcggcccgccggcttctcgcgcgtgtggctgcaggacatcctg
cgcgggcagttgggctttaccggcgcgatcttcagcgacgacctgtcgatggaggcggca
cgcgaaggcggcacgctcacgcaggcggccgacgcggcgctcgctgccggttgcgacatg
gtgctcgtctgcaaccagccggaggcggccgaggtcgtgttgaacggcctgaaggcgcag
gcatcggccgagtcggtgcgacgcctgaagcggatgcgtgcgcgcggcaagtcgttcaag
tgggacaagctgatcgtgcagcccgagtatctgcaggcgcaggcgctgttgagcagcgca
ctcgcgtaa

DBGET integrated database retrieval system