KEGG   Burkholderia ambifaria MC40-6: BamMC406_1099Help
Entry
BamMC406_1099     CDS       T00684                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BamMC406_1099
Enzymes [BR:bac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BamMC406_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1210796..1213117
Genome map
AA seq 773 aa AA seqDB search
MNASDDTLEFTGGLVARLPEPADFGIALAEGFARRMGDLSRRAGAPAVAARWAARAAFAA
SRATAGGHVCVSLGALAQRYEEPVDDVRAALAASGVVAFGTLARGDERPLIVDRLDHLYL
SRYFDYERRLADALVAQAGVAAPGDALSPERLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPTFTAAARTRIAGALGIDEAAFVAALPVPDGEA
AAVAATTQAPAPAPAPASAPVSTSAARRPPARRNVDTRQASLFDDDPQDEAMSAADVAAP
PAASLSPAAAAPTDIDSVGASADPAWIEADELAWLDAIELAPFDPADAADAANASLASTA
ATQADDPAAASPAPAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALDALPADDA
AAASFHDDAGDTLAASTVERLARRFAAYLDALRTALSEPVPDPLPLFDALNRFRILCATR
TGSRGAEHVNALVATHVRQAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDA
HGVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTRE
LVYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRKEPSR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtccgacgatacgctcgaattcaccggcggcctcgtcgcgcgcctgcccgag
cccgcggatttcggcatcgcgctcgcggaaggattcgcgcgccgcatgggtgacctgtcg
cgccgcgcgggtgcgccggccgtggccgcgcgctgggcggcgcgtgccgcgttcgcggcg
agccgtgcgaccgcgggcggccacgtgtgcgtgtcgctcggcgcgctcgcgcagcgctac
gaggagccggtcgacgacgtgcgcgcggcgcttgccgcgagcggcgtggtggcgttcggt
acgctcgcgcgcggcgacgagcggccgctgatcgtcgaccggctcgaccatctgtatctg
tcgcgctatttcgactacgaacggcggcttgccgatgcgctcgtcgcgcaggccggcgtc
gccgcaccgggcgacgcgctgtcgcccgagcgcttgcgcgacagtcttgcgcgttacttc
gggcccgcgaccggcgaggtggactggcagcgcgtcgccgcgatcgttgcgctgaccggg
cgtgtgacgatcgtcagcggcggccccggcaccggcaagacgacgaccgtcgtcggcgtg
ctggcttgtctgctcgacgcgcatccggggctgcgcatcgcgctggcggcgccgaccggc
aaggccgcgcagcggatgcaggaagcgctgcacgcgcgggcgggcgatctgccgccggaa
cttgccgcgcgcctgcccgacacgtcgtacacgctgcatcgcctgctgggcggcggcggc
gcggcgggcttccgccatcaccgcgacaatccgttgccgtatgacctgatcgtcgtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgatgcgctcgcgcccggc
gcacggctcgtgctgctgggcgacaaggatcagctcgccgcggtcgaggccggcgccgtg
ttcgccgagctcagcgcacggccgacgtttaccgccgcggcacgcacgcgcatcgcgggt
gcactcgggatcgacgaagcggctttcgtcgcggcgttgccggtgcccgacggcgaggcg
gcggcggttgcggcgaccactcaagctccggccccagcgccggctccggcatccgcgccg
gtgtcgacgagcgctgcgcgcaggccgccggcgcggcggaacgtggatacgcgccaggcg
tcgctgttcgacgacgatccgcaggacgaagcgatgtccgctgccgatgtcgccgcgccg
ccggccgcttcgttgtcacctgcggcggccgcgccgaccgacatcgatagtgttggcgct
tccgccgatccagcatggatcgaggccgacgaactcgcgtggctcgacgcgatcgagctc
gcgccattcgatccggccgatgcagccgatgcggcaaatgcgtcgcttgcatccaccgcc
gcaacgcaagccgacgaccccgccgcagcgtcacccgcacccgcaccgcttgcagactgc
gtcgtatggctcgaacgcaattaccgtttcggtctcgattcgccgatcggccgtctgtcg
ctggcgatccgccgcggcgacgtgcaggccgcgctcgatgcgttgccggcggacgatgcc
gctgccgcgtcgtttcatgacgacgcgggcgatacgcttgcggcgtcgacggtcgagcgg
ctcgcgcgccggttcgccgcgtacctcgacgcattgcgtaccgcgttgtccgagccggtg
cccgatccgttgccgttgttcgatgcactcaatcgcttccggatcctgtgcgcgacgcgc
accggatcgcgcggcgccgagcacgtcaatgcgctggtggccacgcacgtgcgacaggcc
gcgcgcgtgccgctcgcggtcggtgcacactggttcaccgggcgcccgatcatggtcacg
cgtaacgactatgcactcgggctgttcaacggcgacatcggcatcgcattgccggacgcg
cacggcgtgctgcgcgtgtggttccggcgcgcggacggtactgcgcgcgccgtgtcgccc
gccgcgctgccgccgcacgaaacggcgttcgcgctgacggtccacaagtcgcagggctcc
gaattcgacgaggccgcgctcgtgctgccggcgtcgttcgggcgcgtgctcacgcgcgaa
ctcgtctatacggccgtcacgcgcgcacgcacgcgcgtgcaggtgatcggtccgcggcgc
gtgctcgcgcaggcagtcgcgacgcgcacgcaacgcgattcgggccttgcggcccgcgtc
gacgaggcgctcgcgcggcgtcgcaaggagccgtcgcgatga

DBGET integrated database retrieval system