KEGG   Burkholderia ambifaria MC40-6: BamMC406_1187Help
Entry
BamMC406_1187     CDS       T00684                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1311912..1312853
Genome map
AA seq 313 aa AA seqDB search
MWLHTGPFCIHQRLPPVSDSAVSAFIPAPLQCGRFSLTFERPLVMGILNATPDSFSDGGR
FLARDDALRQAERMIAEGVDLIDIGGESTRPGAPPVPLDEELARVIPLVEALRPLNVPLS
IDTYKPAVMRAALAAGADLINDIWGFRQPGAIDAVREGNSGLCAMHMLGEPQTMQVGEPD
YGDVVTDVRDFLAGRAQALRDAGIAPERICVDPGFGFGKAVVDDNYALLAALADTAPARP
DGRAYPILAGMSRKSMLGAVIGGKPPTERVAASVAAALCAVGRGAAIVRVHDVAATVDAL
KVWNAVREAARQR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcttcacaccggcccgttttgcattcatcaacgcctcccgcccgtgtccgattcc
gctgtttccgcgttcatccccgcgccgctccagtgcggccgtttctcgctgacgttcgaa
cgcccgctcgtgatgggcatcctgaacgcaacccccgattcgttttccgatggcggccgc
ttcctcgcgcgcgacgatgcgttgcgccaggccgagcggatgatcgccgaaggcgtcgac
ctgatcgacatcggcggtgagtcgacgcgtcccggcgcgccgccggtgccgctcgacgag
gaactcgcgcgcgtgatcccgctcgtcgaagcgctgcggccgctgaacgtgccgctgtcg
atcgacacctacaagccggccgtgatgcgcgcggcgctcgcggccggcgccgacctgatc
aacgacatctggggattccgccagccgggggcgatcgacgcggtgcgcgagggcaacagc
gggctgtgcgcgatgcacatgctcggcgagccgcagacgatgcaggtcggcgagcccgac
tacggcgacgtcgtgaccgacgtacgcgactttctcgccgggcgcgcgcaggcgctgcgc
gacgcgggcatcgcgccggagcggatctgcgtcgatccgggcttcggcttcggcaaggcg
gtggtcgacgacaactacgcgctgctggccgccttggcggacacggcgcccgcgcggccc
gacgggcgcgcgtatccgattctcgcgggcatgtcgcgcaagtcgatgctcggcgcggtg
atcggcggcaagccgccgacggaacgcgtcgcggcaagcgtggcggccgcgctgtgcgca
gtcgggcgcggcgccgcgatcgtgcgtgtgcacgacgtcgcggcgacggtcgacgcgctg
aaggtctggaacgccgtgcgcgaagccgcgcggcaacgataa

DBGET integrated database retrieval system