KEGG   Burkholderia ambifaria MC40-6: BamMC406_1292Help
Entry
BamMC406_1292     CDS       T00684                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BamMC406_1292
Enzymes [BR:bac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BamMC406_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1430791..1432011
Genome map
AA seq 406 aa AA seqDB search
MAWAFARRRATRPARRVGTTLVLAVAAACASAATAGRAQAAQSGAADAQCGAAWPRWDAF
KRDFVSADGRVIDVGSADSRTVSEGQAYGLFFALVANDRRTFDTILAWTENNLAQGDLSA
RLPAWLWGRAPDGAWRVLDANAASDADLWIAYTLVEAGRLWRERSYTARGALLAKRVLDD
ETASVPGLGLTLLPGPTGFKLANGQWRVNPSYSPPQLIRGLAARLPDDRRWAALSASTGR
VLLDTAPKGFSPDWALYRAGAGFGPDPQTRAESAYNAIRVYLWAGMLDRADPLAAPLLAR
FAPFADYIAAHGAPPEKVDTTTGVAGPNDGNGGFSAAAVPFLDARGQRALADAQAARVDT
LARQSAPGYYTSVLTLFGLGWREGRYRFGADGSLDARWEGRPCVAR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggcattcgcaaggcgacgggcaacgcggccggcgcggcgcgtcggcacgaca
ctcgtgctggccgtcgcggctgcgtgcgcgtcggccgcgaccgccgggcgcgcgcaggcg
gcgcaaagcggcgcggccgacgcgcagtgcggcgcggcgtggccgcgctgggacgcgttc
aagcgcgatttcgtgtcggccgacggccgggtgatcgacgtcggctcggccgattcgcgc
acggtatcggaggggcaggcgtatggactgttcttcgcgctggtggcgaacgaccggcgc
acgttcgacacgatcctcgcatggaccgagaacaacctcgcgcagggcgacctgagcgcc
cgtctgccggcgtggctgtggggccgcgcgccggacggcgcatggcgcgtgctcgatgcg
aacgcggcgtcggacgccgacctgtggatcgcgtacacgctcgtcgaagccggccggctg
tggcgcgagcgcagctacacggcgcgcggcgcgctgctcgcgaagcgcgtgctggacgac
gagacggccagcgtgccgggcctcggcctcacgctgctgcccgggccgaccggcttcaag
ctggccaacggtcaatggcgcgtgaacccgagctattcgccgccgcagttgatccgcggg
ctcgccgcgcgcctgcccgacgatcggcgctgggccgcgctctcggccagcaccggccgc
gtgctgctcgacaccgcgccgaagggcttttctccggactgggcgctgtatcgcgcgggc
gccggcttcgggcccgatccgcaaacccgcgcggaaagcgcgtacaacgcgatccgcgtg
tacttgtgggccggcatgctcgatcgcgccgatccgctcgccgcgccgctgctcgcgcgg
tttgcaccgtttgccgactacatcgccgcgcatggcgcgccgccggagaaggtcgacacg
acgaccggcgtcgcggggccgaacgacggcaacggcggcttctccgcggcggccgtgccg
ttcctcgacgcgcgcggccagcgtgcgctcgccgatgcgcaggccgcgcgggtcgatacg
ctcgcgcgccagtcggcgcccggctactacacgagcgtgctgacgctgttcggcctcggc
tggcgcgagggccgctaccggttcggcgcggatggatcgctcgacgcgcgctgggagggg
cgtccatgcgtggctcgatga

DBGET integrated database retrieval system