KEGG   Burkholderia ambifaria MC40-6: BamMC406_1383Help
Entry
BamMC406_1383     CDS       T00684                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BamMC406_1383
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BamMC406_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1536148..1537077
Genome map
AA seq 309 aa AA seqDB search
MMNPVKPPRIAVVGSVNVDLVTRAPRLPVPGETLLGTSFQTVHGGKGANQAVAAARLGAS
VAMIGCVGNDAFGARLHDALAAERIDVTHLRRIDGEATGVATITVDAHGANTIVVVPGAN
ACVDAALIDASRDVIAGAALMVCQLEVPIETVARAIGSAIAHRTPVLLNPAPARPLFDAL
LARIDYLVVNETEAESLTGIAVGDDASAVRAADALCAKGVGNVLVTLGARGVCWRGIAGE
GRLGARAVVAVDTTAAGDTFVGGFAAARASGASMDDAIAFGQHAAAISVTRHGAQTSIPT
REEVERAAV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcctgtaaagccaccgcgaatcgccgtcgtcggcagcgtcaacgtcgatctc
gtcacgcgcgcgccgcgtctgcccgtcccgggcgaaacactgcttggcacctcgttccag
accgtccacggcggcaagggggcgaaccaggcggtggccgccgcgcgcctcggtgcgtcg
gtcgcgatgatcggctgcgtcggcaatgacgcgttcggcgcacgcctgcacgacgcgctc
gcggcggagcgtatcgacgtcacgcacctgcgccggatcgacggcgaggccaccggcgtc
gccacgatcacggtcgacgcacacggcgcgaacaccatcgtcgtcgtgcccggtgcgaac
gcctgcgtcgatgccgcattgatcgacgcgtcgcgcgacgtgatcgccggcgcggcgctg
atggtgtgccagctcgaggtgccgatcgagaccgtcgcgcgcgccatcggcagcgccatc
gcccatcggacgcccgtgctgctcaatccggcgcccgcccggccgctgttcgacgcattg
ctggcccgcatcgactacctcgtcgtcaacgaaacggaagcggagtcgctgaccggcatc
gccgtcggcgacgacgcatcagcggtgcgcgccgccgatgcgctgtgcgcgaagggcgtc
ggcaacgtgctggtcacgctcggcgcgcgcggcgtctgctggcgagggattgcgggggag
ggccgccttggggcgagagcggtggtcgccgtcgatacgacggcggccggcgacaccttc
gtcggcggcttcgcggcggcccgtgcgagcggtgcgtcgatggatgacgcgattgcattc
ggccagcacgcggccgcgatcagcgtgacgcgccacggcgcgcagacctcgattccgaca
cgcgaagaagtggagcgtgcggccgtatag

DBGET integrated database retrieval system