KEGG   Burkholderia ambifaria MC40-6: BamMC406_1431Help
Entry
BamMC406_1431     CDS       T00684                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BamMC406_1431
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BamMC406_1431
  Amino acid metabolism
   00310 Lysine degradation
    BamMC406_1431
Enzymes [BR:bac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BamMC406_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1592276..1593553
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAAVASSSAA
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgttgccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgccgccgaagccgcggcaggtgccgccgaagtgaagccggcagcagca
cctgccgcagccgcaccggcagcccagccggctgccgctgtcgcatcgagctcggctgct
gcatcgccggccgcatcgaagctgctggccgagaagggcctgtcggcaggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctcgcagctggcagcgcaccg
aaggccgctccggccgccgcaccggcgaagaccgccgctgcgaagccggcactgccggaa
gtgaaggtgccggcgtcggcagcgacgtggctgaacgaccgtccggaacagcgcgtgccg
atgtcgcgcctgcgtgcgcgtatcgccgagcgcctgctcgagtcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatggctccggtcatggagctgcgtaacaaatac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaatgcggatcaactgagcctcgccgagatcgagaagaagattgcc
gaattcggtcagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggtgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcatgcgacgaaggagcgcccggttgtcgaaaacggc
cagatcgtgatccgtccgatcaactacctggcgctgtcgtatgaccaccggatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgatctgtaa

DBGET integrated database retrieval system