KEGG   Burkholderia ambifaria MC40-6: BamMC406_1577Help
Entry
BamMC406_1577     CDS       T00684                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00860  Porphyrin and chlorophyll metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BamMC406_1577
Enzymes [BR:bac01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BamMC406_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA AAA_22 AAA_16 AAA_30 AAA_3 AAA_2
Motif
Other DBs
NCBI-ProteinID: ACB64064
JGI: BamMC4061577
UniProt: B1YQC6
Position
1:1771045..1772127
Genome map
AA seq 360 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQQPLQQALLLAAIDPSLGGVLVSGPRGTAKSTAARALAEL
LPEGEFVTLPLSASDEQVTGTLDLAHALAANGVRFRPGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHASAQRALGDAIHAARARLSMLDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEHADAVTVSHVERVADAVLRHRRHAGAPPSSGASPS
RGGGERDRDDRSPPDTRRQPDDQPGAAHASASQGEWGYLPPEPAGLRDVKSVVPLPLKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccacgacgccccgcgcacgcgcggtgttcccgttcgcggcgctggtcgcg
cagcaaccgttgcagcaggcgctgctgctcgccgcgatcgatccgtcgctcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatcgaccgccgcgcgcgcgctggcggaattg
ctgcccgaaggcgaattcgtcacgctgccgctgtcggcgagcgacgagcaggtcacgggc
acgctcgacctcgcccatgcgctcgccgccaacggcgtgcgcttccggccgggcctgctc
gcccgcgcgcatcgcggcgtgctgtacgtcgacgaggtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacgtggtcgagcgcgatggcgtg
tcgcacgcgcacgatgcacgtttcgtgctggtgggcacgatgaatcccgaggaaggtgaa
ctgcgcccgcaactgctcgaccgcttcgggctgatggtcgaactcgagaactgcttcgac
gccgcgcagcgcgaacggatcgtgaaggcacgcctcgcgttcgatctcgatccggacgcg
tttcgtgcgcgtcacgcaagcgcgcagcgagcactcggcgacgcgattcatgcggcgcgc
gcccggctgtcgatgctggatttcgacgatgcggttcacgcacgcgtgagcgcgctgtgc
atcgacgcggccgtcgacggcctgcgcgccgacctcgtgatgctgcgcgccgcgcgcgcg
ctcgcggcgctggagcacgccgacgcggtgacggtgtcgcatgtcgaacgcgtggccgac
gcggtgctgcggcatcggcgtcatgcgggcgcgccgccgtcgtcgggcgcgtcgccatcg
cgcggcgggggcgagcgcgaccgcgacgaccgttcgccgcccgacacgcgccggcagccc
gacgatcaaccgggcgcggcacatgcgagcgcatcgcaaggcgagtggggctacctgccg
cccgaaccggccggcctgcgcgacgtgaaaagcgtggtgccgctgccgctaaaaaaacgc
tga

DBGET integrated database retrieval system