KEGG   Burkholderia ambifaria MC40-6: BamMC406_1577Help
Entry
BamMC406_1577     CDS       T00684                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1771045..1772127
Genome map
AA seq 360 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQQPLQQALLLAAIDPSLGGVLVSGPRGTAKSTAARALAEL
LPEGEFVTLPLSASDEQVTGTLDLAHALAANGVRFRPGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHASAQRALGDAIHAARARLSMLDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEHADAVTVSHVERVADAVLRHRRHAGAPPSSGASPS
RGGGERDRDDRSPPDTRRQPDDQPGAAHASASQGEWGYLPPEPAGLRDVKSVVPLPLKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccacgacgccccgcgcacgcgcggtgttcccgttcgcggcgctggtcgcg
cagcaaccgttgcagcaggcgctgctgctcgccgcgatcgatccgtcgctcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatcgaccgccgcgcgcgcgctggcggaattg
ctgcccgaaggcgaattcgtcacgctgccgctgtcggcgagcgacgagcaggtcacgggc
acgctcgacctcgcccatgcgctcgccgccaacggcgtgcgcttccggccgggcctgctc
gcccgcgcgcatcgcggcgtgctgtacgtcgacgaggtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacgtggtcgagcgcgatggcgtg
tcgcacgcgcacgatgcacgtttcgtgctggtgggcacgatgaatcccgaggaaggtgaa
ctgcgcccgcaactgctcgaccgcttcgggctgatggtcgaactcgagaactgcttcgac
gccgcgcagcgcgaacggatcgtgaaggcacgcctcgcgttcgatctcgatccggacgcg
tttcgtgcgcgtcacgcaagcgcgcagcgagcactcggcgacgcgattcatgcggcgcgc
gcccggctgtcgatgctggatttcgacgatgcggttcacgcacgcgtgagcgcgctgtgc
atcgacgcggccgtcgacggcctgcgcgccgacctcgtgatgctgcgcgccgcgcgcgcg
ctcgcggcgctggagcacgccgacgcggtgacggtgtcgcatgtcgaacgcgtggccgac
gcggtgctgcggcatcggcgtcatgcgggcgcgccgccgtcgtcgggcgcgtcgccatcg
cgcggcgggggcgagcgcgaccgcgacgaccgttcgccgcccgacacgcgccggcagccc
gacgatcaaccgggcgcggcacatgcgagcgcatcgcaaggcgagtggggctacctgccg
cccgaaccggccggcctgcgcgacgtgaaaagcgtggtgccgctgccgctaaaaaaacgc
tga

DBGET integrated database retrieval system