KEGG   Burkholderia ambifaria MC40-6: BamMC406_1680Help
Entry
BamMC406_1680     CDS       T00684                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BamMC406_1680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_1680
  Lipid metabolism
   00071 Fatty acid degradation
    BamMC406_1680
  Amino acid metabolism
   00350 Tyrosine metabolism
    BamMC406_1680
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BamMC406_1680
   00626 Naphthalene degradation
    BamMC406_1680
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BamMC406_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1878571..1879620
Genome map
AA seq 349 aa AA seqDB search
MVKAVVYEAFGAAPRLMNVDDPTPAADGVVIEVKATGVCRSDWHGWMGHDPDIVLPHVPG
HELAGVVVAAGAAVTRWKAGDRVTVPFVGGCGHCPECHSGNQQVCEQQFQPGFTHWGSFA
QFVGIHHADLNLVRLPDALDFPTAASLGCRFVTSFRAVVDQGRTSAGQWVAVHGCGGVGL
SAIMIANAIGANVVAIDISDQALALARSVGATATVNASQVADVVDAVKEITRGGAHVSLD
ALGHPTTCFNSISNLRRRGKHVQVGLMLGEHATPAVPMSKVIAHELEILGSHGMQAHRYD
AMLDMVHAGTLAPNRLIGKEISLGQSIDALMNMNRFEGAGVTVVTDFSG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagcagtcgtttatgaagcgttcggcgcggcgccgcggttgatgaatgtcgac
gacccgacgccggcagccgacggcgtcgtgatcgaagtgaaggcgaccggcgtgtgccgc
agcgactggcacggctggatggggcacgacccggacatcgtgctgccgcatgtgccgggg
cacgaactcgccggcgtcgtggtcgcggcgggcgcggcggtcacgcgctggaaggccggc
gaccgcgtcacggtgccgttcgtcggcggctgcgggcactgcccggaatgccactccggc
aaccagcaggtatgcgagcaacagtttcagcccggcttcacgcactggggctcgttcgcc
cagttcgtcggcatccatcacgcggacctgaacctggtgcggctgcccgacgcgctcgat
ttcccgaccgcggcgagcctcggttgccgcttcgtgacgtcatttcgcgcggtggtcgac
caggggcgcacgtcggccggccagtgggtcgccgtgcacggctgcggaggcgtcggtctg
tcggcgatcatgatcgcgaatgcgatcggggcgaacgtcgtcgcgatcgacatttcggac
caggcgctcgcgctcgcgcgatcggtcggcgcaacggcgaccgtcaatgcgtcgcaagtc
gccgacgtggtcgatgcggtgaaggagatcacgcgcggtggcgcacacgtgtcgctcgat
gcgctcggccatccgaccacctgcttcaactcgatcagcaatctgcgccgccgcggcaag
catgtgcaggtcgggctgatgctcggcgagcatgcgacgccagccgtgccgatgagcaag
gtcatcgcgcacgaactggagattctcggcagccacgggatgcaggcgcatcgttatgac
gcgatgctcgacatggtgcacgccggcacgctcgcgccgaaccggttgatcggcaaggaa
atcagtctcggccagtcgattgatgcgctgatgaacatgaaccggttcgaaggcgccggc
gtgacggtcgtgacggatttttcgggctga

DBGET integrated database retrieval system