KEGG   Burkholderia ambifaria MC40-6: BamMC406_1680Help
Entry
BamMC406_1680     CDS       T00684                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00071  Fatty acid degradation
bac00350  Tyrosine metabolism
bac00625  Chloroalkane and chloroalkene degradation
bac00626  Naphthalene degradation
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_1680
  Lipid metabolism
   00071 Fatty acid degradation
    BamMC406_1680
  Amino acid metabolism
   00350 Tyrosine metabolism
    BamMC406_1680
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BamMC406_1680
   00626 Naphthalene degradation
    BamMC406_1680
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BamMC406_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ELFV_dehydrog Methyltransf_25 2-Hacid_dh_C ADH_zinc_N_2 Methyltransf_11 UDPG_MGDP_dh_N Methyltransf_12 Urocanase
Motif
Other DBs
NCBI-ProteinID: ACB64166
JGI: BamMC4061680
UniProt: B1YR02
Position
1:1878571..1879620
Genome map
AA seq 349 aa AA seqDB search
MVKAVVYEAFGAAPRLMNVDDPTPAADGVVIEVKATGVCRSDWHGWMGHDPDIVLPHVPG
HELAGVVVAAGAAVTRWKAGDRVTVPFVGGCGHCPECHSGNQQVCEQQFQPGFTHWGSFA
QFVGIHHADLNLVRLPDALDFPTAASLGCRFVTSFRAVVDQGRTSAGQWVAVHGCGGVGL
SAIMIANAIGANVVAIDISDQALALARSVGATATVNASQVADVVDAVKEITRGGAHVSLD
ALGHPTTCFNSISNLRRRGKHVQVGLMLGEHATPAVPMSKVIAHELEILGSHGMQAHRYD
AMLDMVHAGTLAPNRLIGKEISLGQSIDALMNMNRFEGAGVTVVTDFSG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagcagtcgtttatgaagcgttcggcgcggcgccgcggttgatgaatgtcgac
gacccgacgccggcagccgacggcgtcgtgatcgaagtgaaggcgaccggcgtgtgccgc
agcgactggcacggctggatggggcacgacccggacatcgtgctgccgcatgtgccgggg
cacgaactcgccggcgtcgtggtcgcggcgggcgcggcggtcacgcgctggaaggccggc
gaccgcgtcacggtgccgttcgtcggcggctgcgggcactgcccggaatgccactccggc
aaccagcaggtatgcgagcaacagtttcagcccggcttcacgcactggggctcgttcgcc
cagttcgtcggcatccatcacgcggacctgaacctggtgcggctgcccgacgcgctcgat
ttcccgaccgcggcgagcctcggttgccgcttcgtgacgtcatttcgcgcggtggtcgac
caggggcgcacgtcggccggccagtgggtcgccgtgcacggctgcggaggcgtcggtctg
tcggcgatcatgatcgcgaatgcgatcggggcgaacgtcgtcgcgatcgacatttcggac
caggcgctcgcgctcgcgcgatcggtcggcgcaacggcgaccgtcaatgcgtcgcaagtc
gccgacgtggtcgatgcggtgaaggagatcacgcgcggtggcgcacacgtgtcgctcgat
gcgctcggccatccgaccacctgcttcaactcgatcagcaatctgcgccgccgcggcaag
catgtgcaggtcgggctgatgctcggcgagcatgcgacgccagccgtgccgatgagcaag
gtcatcgcgcacgaactggagattctcggcagccacgggatgcaggcgcatcgttatgac
gcgatgctcgacatggtgcacgccggcacgctcgcgccgaaccggttgatcggcaaggaa
atcagtctcggccagtcgattgatgcgctgatgaacatgaaccggttcgaaggcgccggc
gtgacggtcgtgacggatttttcgggctga

DBGET integrated database retrieval system