KEGG   Burkholderia ambifaria MC40-6: BamMC406_1731Help
Entry
BamMC406_1731     CDS       T00684                                 

Definition
RNA polymerase sigma factor RpoS
Orthology
K03087  
RNA polymerase nonessential primary-like sigma factor
Organism
bac  Burkholderia ambifaria MC40-6
Brite
Transcription machinery [BR:bac03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BamMC406_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1934475..1935560)
Genome map
AA seq 361 aa AA seqDB search
MPKSKRHEPQAESEKISRATQASVERAGASKDDEDDVAENERDLEASDAEADGDGEREGR
AEAAPDVDDFRALLQAELTADTIQHYLNRISVKPLLTVEEEQRYSRLAKAGEFEARQVMI
ERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPTRGFRFSTYATWWIRQSIE
RAIMNQARTVRLPVHVIRELNQVLRAKRHLEKNSMSTGEAAERREASIDDIAYLTGKTAE
EVTDILALNEHTASLDAPLDLDPASSLLDLLPDDQSQSPDAEVQHRELETLTRAWLSRLS
DKHRHVIERRFGLNHIEPATLEELADEMGLTRERVRQIQQEALVRLKRFFASNGVRKDAV
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaatcgaagcgccacgagccgcaagccgagtctgagaagatcagtcgtgccacg
caagcatcggtggagcgagctggcgcttcgaaggacgacgaagacgacgtcgcggaaaac
gaacgtgatctcgaggcaagcgacgccgaagcggacggcgacggcgagcgcgaaggccgt
gcggaagcagcgcccgacgtcgacgatttccgcgcattgctgcaggccgagctcacggcc
gacacgatccagcattacctgaaccgcatcagcgtgaagccgctgctgaccgtcgaggag
gagcagcgctattcgcggctcgcgaaggccggcgaattcgaggcgcggcaggtgatgatc
gagcgcaacctgcgtctcgtcgtcagtatcgcgaagggttacctgaaccgcggcgtgccg
ctgctcgacctgatcgaggaaggcaacctcggcctgatgcacgcgatcgagaaattcgac
ccgacgcgcggctttcgcttctcgacctatgcgacgtggtggattcgccagagcatcgag
cgggcgatcatgaaccaggcgcgcaccgtgcgcctgcccgtgcacgtgatccgcgagctg
aaccaggtgctgcgcgcgaagcgccacctcgaaaagaattcgatgtcgacgggcgaggcg
gccgagcgccgcgaagccagcatcgacgacatcgcctatctcaccggcaagaccgccgag
gaagtcaccgacatcctcgcgctcaatgagcacaccgcatcgctcgacgcgccgctcgac
ctcgatcccgcgagcagcctgctcgatctgctgcccgacgaccagagccagtcgcccgac
gccgaggtgcagcaccgagagctcgagacgctcacgcgcgcgtggctgtcacgtctgtcc
gacaagcaccgccacgtgatcgagcgccgcttcgggctgaaccacatcgaaccggccacg
ctcgaggagctggccgacgagatggggctcacgcgcgagcgcgtgcggcagatccagcag
gaagcgctggtgcgcctcaagcggttctttgcctccaacggcgtgcgcaaggacgccgtt
ctgtaa

DBGET integrated database retrieval system