KEGG   Burkholderia ambifaria MC40-6: BamMC406_1736Help
Entry
BamMC406_1736     CDS       T00684                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BamMC406_1736 (recR)
DNA repair and recombination proteins [BR:bac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BamMC406_1736 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1939631..1940227)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtccgcgctcgtcgaggcgctgcgtgtcctgcccggcgtc
gggccgaaatccgcgcagcgcatggcgtaccacctgatgcagcacgatcgggagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcacggaagcgcagatctgcgaggtgtgcagcgacgacgagcgtgatccgacg
ctgctgtgcgtcgtcgagacgccggccgaccagatcatgctcgagcagacgatgacgtac
cgcgggctgtatttcgtgctgatggggcggctgagcccgctcgacgggatcggcccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgagggcgaagccaccgcgcactacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcgcgcggcgtgccggtcggcggcgagctc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcacgatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system