KEGG   Burkholderia ambifaria MC40-6: BamMC406_1763Help
Entry
BamMC406_1763     CDS       T00684                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BamMC406_1763
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_1763
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BamMC406_1763
Enzymes [BR:bac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BamMC406_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1968987..1970438)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRALPYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENASDITPLKTLGTENGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGDALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATQSNDEQVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLDP
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKAFIAAH
TRA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctgtacctgccggccgagtatccgaaggtg
tcggccgacgaactggcgcgctggcgcgcgctgccatacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgccgtatacagcaacacgcgccatggcgagaacgcgtccgacatcacgccg
ctgaagacgctcggcaccgagaacggcacggcgctgtcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgacgcgctgaacattctcggcgcgacgtcgggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcccagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcagtccaacgac
gagcaggtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcgggtcacatc
gcgcggatgatgggcctgccgatcgcgaagctcgtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcctatcgcgtgcgcagcgcagagaacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgaacgcttcgtgttcgac
ctgctcggccgcgatccggcacgcgtgatgcagctgttccgcgacgtcgaggagaagggc
ggtttcgaccttgcggcgagcggcgatttcgcgcgcgtggccgagttcggcttcgtgtcg
ggccgcagcagccacacggaccgcatcgcgacgatccgcgacgtgttctcgcgctacgac
acgatgatcgatacgcacacggccgacggcgtgaaggtcgcgcgcgagcatctcgacccg
ggcgtgccgatggtcgtgctggagacggcccagccgatcaagttcggcgagacgatccgc
gaagcgctcgatcgcgaagccgagcggccggctgcattcgacgggctcgaggcgctgccg
cagcgtttcgaggtcgtgaaggccgacgcgcaacaggtgaaggccttcatcgccgcgcat
actcgcgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system