KEGG   Burkholderia ambifaria MC40-6: BamMC406_1763Help
Entry
BamMC406_1763     CDS       T00684                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00260  Glycine, serine and threonine metabolism
bac00750  Vitamin B6 metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01230  Biosynthesis of amino acids
Module
bac_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_1763
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BamMC406_1763
Enzymes [BR:bac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BamMC406_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACB64248
JGI: BamMC4061763
UniProt: B1YRH4
Position
1:complement(1968987..1970438)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRALPYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENASDITPLKTLGTENGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGDALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATQSNDEQVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLDP
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKAFIAAH
TRA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctgtacctgccggccgagtatccgaaggtg
tcggccgacgaactggcgcgctggcgcgcgctgccatacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgccgtatacagcaacacgcgccatggcgagaacgcgtccgacatcacgccg
ctgaagacgctcggcaccgagaacggcacggcgctgtcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgacgcgctgaacattctcggcgcgacgtcgggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcccagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcagtccaacgac
gagcaggtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcgggtcacatc
gcgcggatgatgggcctgccgatcgcgaagctcgtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcctatcgcgtgcgcagcgcagagaacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgaacgcttcgtgttcgac
ctgctcggccgcgatccggcacgcgtgatgcagctgttccgcgacgtcgaggagaagggc
ggtttcgaccttgcggcgagcggcgatttcgcgcgcgtggccgagttcggcttcgtgtcg
ggccgcagcagccacacggaccgcatcgcgacgatccgcgacgtgttctcgcgctacgac
acgatgatcgatacgcacacggccgacggcgtgaaggtcgcgcgcgagcatctcgacccg
ggcgtgccgatggtcgtgctggagacggcccagccgatcaagttcggcgagacgatccgc
gaagcgctcgatcgcgaagccgagcggccggctgcattcgacgggctcgaggcgctgccg
cagcgtttcgaggtcgtgaaggccgacgcgcaacaggtgaaggccttcatcgccgcgcat
actcgcgcgtaa

DBGET integrated database retrieval system