KEGG   Burkholderia ambifaria MC40-6: BamMC406_1915Help
Entry
BamMC406_1915     CDS       T00684                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bac00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2130988..2132184)
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDA
NTAAHVEAKLRAAGSKTIVLYGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKESLVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASG
GPFRTREPATLADVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSF
EKPDYTRFPCLALALKALEEGGIASAALNAANEIAVEAFLERRIGFMAIAATVDAVLNAL
PNRSPNGLDDVLAADAEARRLAAEIIAKAPAPRVERTV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacactgctcggttccacgggctcgatcggagacagcacgctcgac
gtggtcgcccgccatcccgagcgtttctcggtctatgcgttgaccgcgcaccgcaacggc
gacaagctcgtcgagcagtgcctgcgcttcgcgcccgaagtcgcggtggtcggcgatgcg
aacacggcggcgcacgtcgaggccaagctgcgcgcggcgggcagcaagaccatcgtgctg
tacgggccgcaggcgctcgtcgacgtgtcgaagagcgacggctgcgacaccgtcgtcgcg
gcgatcgtcggcgcggccggcctggcgccgagcctcgcggccgcgcgcgccggcaagcgc
atcctgctggcgaacaaggaatcgctcgtgatgtcgggcgcgatcttcatggacgccgtg
cgtgaccatggcgcgatcctgttgccggtcgacagcgaacacaacgcgatcttccagtgc
atgccgcgcgacgagaacgagcacggcgggatctcgaagatcatcctgaccgcatcgggc
ggcccgttccgcacgcgtgagcccgccacgctcgccgacgtgacgccggacgaggcgtgc
aagcacccgaactgggtgatgggccgcaagatttcggtcgattccgcgacgatgatgaac
aagggcctcgaggtgatcgaggcgcactggatcttcggtctgccgggcgaccggatcgac
gtgctgatccacccgcagagcgtgatccattcgctcgtgtcgtaccgcgacggctcggtg
ctcgcccagctcggcaaccccgacatgcgcacgccgatcgcgcacgcgctggcgttcccg
gagcgcgtcgacgcgggcgtcgaccagctcgaccttgcgcagatcgcgcagctgtcgttc
gagaagcccgattacacgcgcttcccgtgcctcgcgctcgcgctgaaggcgcttgaagag
ggtggtatcgcgagcgccgcgttgaacgcggcgaacgaaatcgcggtcgaagcgtttctc
gagcgccggatcggcttcatggcgatcgcggccacggtcgacgcggtgctcaacgcgctg
ccgaaccgcagcccgaacgggctcgacgacgtccttgcggcggatgccgaggcacgccgc
ctcgccgccgagatcattgcgaaagcgcctgcgccccgcgtggagcgtactgtctga

DBGET integrated database retrieval system