KEGG   Burkholderia ambifaria MC40-6: BamMC406_1950Help
Entry
BamMC406_1950     CDS       T00684                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00630  Glyoxylate and dicarboxylate metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01200  Carbon metabolism
Module
bac_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BamMC406_1950
Enzymes [BR:bac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BamMC406_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACB64432
JGI: BamMC4061950
UniProt: B1YSJ6
Position
1:2172286..2173593
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQQQWETDPRWKGIKRSYTADDVVRLRGSIAVEHTLAKRGAQKLWSLMNEE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDYFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPFLTGERTVEGFFRTKPGIEQAISRGLAYAPYADLVWCETGKPDLEYAKKFAE
AIHKQFPGKMLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacagcaacaggcacaggaactgcaacagcaatgggaaaccgatccgcgctgg
aaaggcatcaagcgcagctacaccgctgacgacgtcgttcgcctgcgcggctcgatcgcc
gtcgagcacacgctggccaagcgcggcgcgcaaaagctgtggagcctcatgaacgaagag
ccgttcgtcaacgcgctcggcgcgctgaccggcaaccaggcgatgcagcaggtgaaggcc
ggtctcaaggcgatctacctgtcgggttggcaagtggccggtgacgcgaacgtcgcgggc
gaaatgtacccggaccagtcgctgtacccggcgaactcggtaccgctcgtcgtcaagcgc
atcaacaacacactgacgcgcgccgaccagatccagtggtccgaaggcaagaacccgggc
gacgaaggttacgtcgactacttcgcgccgatcgtcgcggacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcaggcgcatcgggtgtc
cacttcgaggatcagcttgcgtcggtgaagaaatgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaggccgtcgcgaagctgtcggcggcgcgtctggccgctgacgtgatg
ggcacgccgacagtgctggtcgcgcggaccgacgcggaggcagcggacctgatcacgtcc
gacatcgacgacaacgacaagccgttcctgacgggcgagcgtacggtcgaaggcttcttc
cgcacgaagccgggcatcgagcaggcgatctcgcgcggcctcgcgtatgcgccgtacgcc
gacctggtctggtgcgaaacgggcaagccggatctcgagtacgcgaagaagttcgccgaa
gcgatccacaagcagttcccgggcaagatgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactgggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcacgcagatgagcgcgttcgtcgaactgcagcaggcc
gagttcgcggcggccgacaagggcttcacggccgtcaagcaccagcgcgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaggcatcgacgaccgcgctgcac
ggctcgaccgaggacgaacagttcttcgacggcaagaaggtcgcgtaa

DBGET integrated database retrieval system