KEGG   Burkholderia ambifaria MC40-6: BamMC406_1954Help
Entry
BamMC406_1954     CDS       T00684                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00620  Pyruvate metabolism
bac00630  Glyoxylate and dicarboxylate metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01200  Carbon metabolism
Module
bac_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BamMC406_1954
   00630 Glyoxylate and dicarboxylate metabolism
    BamMC406_1954
Enzymes [BR:bac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BamMC406_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACB64436
JGI: BamMC4061954
UniProt: B1YSK0
Position
1:2176299..2177891
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMAITGEIKPGYEAILTPEALALVAALHRTFEPRRQTLLQDRVERTKRLDA
GERPDFLADTKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYRLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPQANEKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIAKQRDDVQIEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REFTKAELDNVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatggcgatcaccggcgaaatcaagccggga
tacgaagcaatcctgacgcctgaagcactcgcgctcgtcgcggcgctgcaccgtacgttc
gagccgcgtcgccagacgctgctgcaggaccgcgtcgaacgcaccaagcgcctcgacgcc
ggcgaacgccccgatttcctggccgacacgaaggcgatccgcgaaggcgactggaaggtg
gcgccgctgccggccgacctgcaatgccgccgtgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactccggcgccgactcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccggctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcatctcgacgagaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgatcgcgcgcggctcgggcccctacttctacctgccgaagatggaaagccatctggag
gcgcgcctgtggaacgacatcttcgtcgcggcacaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgagctgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgatcgcgacttctgcctggccgaccgcgcgaagatc
acgatgacggtgccgttcatgcgcgcgtacgcactgctgctgctgaagacctgccacaag
cgcaatgcaccggccatcggcgggatgagcgcgctgattccgatcaagaacgatccacaa
gcaaacgagaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaggaattcgtc
aaggtgctcggcgacaagccgaaccagatcgccaagcagcgcgacgacgtgcagatcgaa
ggcaggaatctgctcgacttccagcctgaggcgccgatcaccgaggccggcctgcgcaac
aacatcaacgtcggcatccattatctcggcgcgtggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagacgcggccaccgccgaaatctcccgctcgcaggtatggcaa
tggatccgctcgccgaagggcgtgctcgacgacggccgcaaggtcacggcggaactcgtg
cgcgaattcacgaaggccgagctcgacaacgtgaagcgctccgtcggcggcaatacgcag
ccctacgagcgtgctgcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system