KEGG   Burkholderia ambifaria MC40-6: BamMC406_2168Help
Entry
BamMC406_2168     CDS       T00684                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00051  Fructose and mannose metabolism
bac00562  Inositol phosphate metabolism
bac00710  Carbon fixation in photosynthetic organisms
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
bac01230  Biosynthesis of amino acids
Module
bac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bac_M00002  Glycolysis, core module involving three-carbon compounds
bac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_2168
   00051 Fructose and mannose metabolism
    BamMC406_2168
   00562 Inositol phosphate metabolism
    BamMC406_2168
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BamMC406_2168
Enzymes [BR:bac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BamMC406_2168
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BamMC406_2168
  Exosomal proteins of bladder cancer cells
   BamMC406_2168
  Exosomal proteins of melanoma cells
   BamMC406_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB64647
JGI: BamMC4062168
UniProt: B1YTQ9
Position
1:complement(2417794..2418549)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGA
GRVVFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
QDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaatgaagtggtgcagggcgcgggcgcggtggccgctgaaacg
tcgatcggcgtgtgcgtgccgtttccgtacctcgcgcaggttcaggcgcagctcggcgct
ggccgtgtcgtgttcggcgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgctgcggcgatggtggcggagttcggtgcgcattatgcgatcgtcggtcactcg
gagcgtcgtgcgtatcacggcgagcgcaacgagaccgtcgcggcgaagacgcagcgcgcg
ctcgcggcaggcctcacgcccgtcgtgtgcgtcggcgaaacgctcgacgagcgtgaagcg
ggcgcgaccgagcaggtggtcggtgcgcagctcgacgccgtgctggccgtgctgacggct
gacgaggctgctcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcattcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtctcggtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
caagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system