KEGG   Burkholderia ambifaria MC40-6: BamMC406_2168Help
Entry
BamMC406_2168     CDS       T00684                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BamMC406_2168 (tpiA)
   01230 Biosynthesis of amino acids
    BamMC406_2168 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_2168 (tpiA)
   00051 Fructose and mannose metabolism
    BamMC406_2168 (tpiA)
   00562 Inositol phosphate metabolism
    BamMC406_2168 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BamMC406_2168 (tpiA)
Enzymes [BR:bac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BamMC406_2168 (tpiA)
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BamMC406_2168 (tpiA)
  Exosomal proteins of bladder cancer cells
   BamMC406_2168 (tpiA)
  Exosomal proteins of melanoma cells
   BamMC406_2168 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2417794..2418549)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGA
GRVVFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
QDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaatgaagtggtgcagggcgcgggcgcggtggccgctgaaacg
tcgatcggcgtgtgcgtgccgtttccgtacctcgcgcaggttcaggcgcagctcggcgct
ggccgtgtcgtgttcggcgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgctgcggcgatggtggcggagttcggtgcgcattatgcgatcgtcggtcactcg
gagcgtcgtgcgtatcacggcgagcgcaacgagaccgtcgcggcgaagacgcagcgcgcg
ctcgcggcaggcctcacgcccgtcgtgtgcgtcggcgaaacgctcgacgagcgtgaagcg
ggcgcgaccgagcaggtggtcggtgcgcagctcgacgccgtgctggccgtgctgacggct
gacgaggctgctcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcattcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtctcggtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
caagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system