KEGG   Burkholderia ambifaria MC40-6: BamMC406_2603Help
Entry
BamMC406_2603     CDS       T00684                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BamMC406_2603 (glpK)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    BamMC406_2603 (glpK)
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BamMC406_2603 (glpK)
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BamMC406_2603 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2890489..2891991
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVA
AEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSLKKQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTREWDSELLELLDIPRSMLPDVKASSEIYGHTKTTVFASKIPLAG
IAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGDDVQYA
LEGSIFIAGAVVQWLRDGVGIIKTAAEIEALAASVPHTDGVYLVPAFAGLGAPHWNARAR
GSVFGVTRGTTAAHLARAALDSIAYQSLDVLAAMEADSGISIGELRVDGGASANDLLMQF
QADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDEVRSQWQLDRRFSPSMPKEQVEQ
RMAGWQRAVRAAKAWADDTQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccagtacatcctcgcgcttgaccagggcaccacgagttcccgcgcaatgctg
ttcgatcgccagggcaatatcgtatcgatcgcccagaaggaattcgaacagatctacccg
caacccggctgggtcgagcacgaccctcaggaaatctggtcgacgcaggcgggcgtcgcg
gcggaagccgtcacccgcaccggcctgaacggcacgtcgatcgccgcgatcggcatcacc
aaccagcgcgagacgacgatcgtctgggatcgcgagacgggccagcccgtctacaacgcg
atcgtctggcaggaccgccgcaccgccgacttctgcgattcgctgaagaagcagggcctc
gaagcgaaggtgcgcgcgaagaccggcctgccgatcgactcgtacttctccgcgacgaag
atccgctggatcctcgacaacgtgccgggcgcgcgcgacaaggcgcgccagggcaagctc
gcgttcggcaccgtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtg
accgacgtgacgaacgcgtcgcgcacgatgctgttcaacatccatacgcgcgagtgggac
agcgagctgctcgaactgctcgacatcccgcgcagcatgctgccggacgtgaaggcgtcg
tcggaaatctacggccacacgaaaaccaccgtgttcgcgtcgaagatcccgctcgcgggc
atcgccggcgaccagcacgcggcgttgttcggccagatgtgcacgacgtcgggcatggtg
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgacaagccgatcgag
tcgaagaacaacctcgtcacgacgatcgcctggcagatcggcgacgacgtgcagtacgcg
ctcgaaggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacggtgtgggc
atcatcaagaccgccgccgaaatcgaagcgctcgccgcgagcgtgccgcataccgacggc
gtctatctcgtgccggcgttcgccggcctcggcgcgccgcactggaacgcgcgggcgcgc
ggctcggtgttcggcgtgacgcgcggcacgacggccgcgcatctcgcgcgtgcggcgctc
gattcgatcgcgtaccagtcgctcgacgtgctggccgcgatggaagccgattcgggcatc
agcatcggcgagctgcgcgtcgacggcggcgcgagcgcgaacgacctgctgatgcagttc
caggccgacctgctcggcgtcgacgcggtgcgtccgcagatcaccgagacgaccgcgctc
ggcgcggcctacctcgccggcctcgcgatcggctactggaagaacctcgacgaagtgcgc
agccagtggcagctcgatcgccgcttctcgccgtcgatgccgaaggagcaggtcgagcag
cgcatggcgggctggcagcgcgcggtgcgcgccgccaaggcatgggccgacgacacgcag
taa

DBGET integrated database retrieval system