KEGG   Burkholderia ambifaria MC40-6: BamMC406_2774Help
Entry
BamMC406_2774     CDS       T00684                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BamMC406_2774
   01230 Biosynthesis of amino acids
    BamMC406_2774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_2774
  Energy metabolism
   00680 Methane metabolism
    BamMC406_2774
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_2774
Enzymes [BR:bac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BamMC406_2774
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BamMC406_2774
  Exosomal proteins of melanoma cells
   BamMC406_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:3072831..3073577
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLREAGYTFDIAYTSVLKR
AIRTLWHVQDRMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTP
PPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRSGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDEDLKPLKHYYLGDQDAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccaggccggc
gaactgctcagggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacactgtggcacgtgcaggaccggatggacctgatgtacctgccggtcgtc
cactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaaggcggaa
acggccgccaagttcggcgacgaccaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgaacgcgcgccgttcaacgacccgcgctacgcgaag
gtgccccgcgagcagctgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgaatcgatcgcgccggccgtccgctcgggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatttcggacagcgac
attgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgagctcgacgaagacctg
aagccgctcaagcactactacctcggcgaccaggacgcgatcgcgaaggcgcaggccgcc
gtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system