KEGG   Burkholderia ambifaria MC40-6: BamMC406_3125Help
Entry
BamMC406_3125     CDS       T00684                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BamMC406_3125
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BamMC406_3125
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BamMC406_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(21260..22045)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGV
AMDVTNEDAVNSGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFSDWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFIVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcaagcggcatcggcaag
gaaatcgcactggagctggccaaggcgggcgcggcggtcgcgatcgccgacctgaaccag
gacggcgcgaacgcggttgccgacgagatcaataaggcaggcggcaaggcgatcggcgtc
gcgatggacgtgaccaatgaggacgccgtgaacagcggcatcgacaaggtcgccgaagcg
ttcggctcggtcgacatcctcgtatcgaacgccggcattcagatcgtcaatccgatcgag
aactactcgttctccgactggaagaagatgcaggcgatccatgtcgacggcgcattcctg
acgacgaaggccgcgctcaagcacatgtacaaggatgatcgcggcggcgtcgtgatctac
atgggctcggtgcactcgcacgaagcgtcgccgctgaagtcggcctacgtgacggccaag
cacggcctgctcggcctcgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtgcgc
tcgcacgtcgtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccggag
caggcgaaggagctcgggatcagcgaagaggaagtgatcaagaaggtgatgctcggcaac
acggtcgacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcgttcccgagcgccgcgctcacggggcagtcgttcatcgtcagccacggctggttcatg
cagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system