KEGG   Burkholderia ambifaria MC40-6: BamMC406_3853Help
Entry
BamMC406_3853     CDS       T00684                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00260  Glycine, serine and threonine metabolism
bac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01130  Biosynthesis of antibiotics
bac01230  Biosynthesis of amino acids
Module
bac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_3853
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BamMC406_3853
Enzymes [BR:bac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BamMC406_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACB66320
JGI: BamMC4063853
UniProt: B1Z1N9
Position
2:844496..845689
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDHGHFGPYGGVFVAETLIHALDELRTAYDKFRNDPDFVAEYERELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGRHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctccctgatgatcacggccatttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgaactgcgcaccgcgtatgacaaattccggaacgac
cccgatttcgtcgccgaatacgagcgcgaactgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggaggcgcgcagatctacctgaagcgc
gaagatctgaaccacaccggcgcgcacaagatcaacaacgtgatcgggcaggcgctgctt
gccaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgacggcgaccatctgcgcgcgcttcgggatggagtgcatcgtctacatgggcgccgag
gacgtgcgccgccaggccgcgaacgtctaccggatgaagctgcttggagctacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtat
ccggcgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccg
gaactcgccggccggcagccggacgcggtgattgcatgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtatatcgacgacacgtcggtgcagctgatcggcgtcgaagcg
gctggcgacggcctcgacaccggtcgtcacgcggcgtcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggtgtcggccccgagcacgcatggctgaag
gacagcggccgcgcgcaatacgtgccgatcaccgacgaagaggcgctgaaggcgttccac
gactgctgccggatcgaggggatcatccccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacattgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgcgctctga

DBGET integrated database retrieval system