KEGG   Burkholderia ambifaria MC40-6: BamMC406_3870Help
Entry
BamMC406_3870     CDS       T00684                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BamMC406_3870
   00052 Galactose metabolism
    BamMC406_3870
   00500 Starch and sucrose metabolism
    BamMC406_3870
   00520 Amino sugar and nucleotide sugar metabolism
    BamMC406_3870
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BamMC406_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:866247..867134
Genome map
AA seq 295 aa AA seqDB search
MLKVTRAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccagggccgtgtttcccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtattaccgagatgatcttcgtgacggggcgcagc
aagcgcgcgatcgaggaccacttcgacaagtcctacgagatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtgaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgttgtgcgcggaaaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgcgagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaagacgcgccgtcg
aacctcggcgtggtcggccgctacgtattcatgccgacgatcttcgatcatctgcgcaag
ctcaagccgggcgccggcggcgaactgcagctgaccgacgccgtccagtcgctgctcgcg
aacgaacaggtgctcgcgtatcgctacttcggcacgcgtttcgattgcggcagcaagatc
ggttatctcaaggcgaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcctgcccgcgctggctgctgtcgcataa

DBGET integrated database retrieval system