KEGG   Burkholderia ambifaria MC40-6: BamMC406_4272Help
Entry
BamMC406_4272     CDS       T00684                                 

Definition
3-phosphoshikimate 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bac00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1329095..1330396)
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGTPLRGDIQPSANKNAVLPILCASLLTDQPLRLVGVPDITDVRKILDIFRTL
GSDVSVDFTTGILELHHRNTTFDPAVHRLPEAMRSSIMLIPPLLARFGVARLENDVKGCT
LGVREIDPHVEVFERFGAHIERTPDSLIVRADGPLTANHHWFDYASVTTTENFALCATAA
SGTSTLMNAASEPHVQEFCQFLAMIGVSIEGIGTSRLCVTGGGKLGGGEFRFAEDFHEIA
TFLALGAITGGDITVRNSSPEHFPLIDRTFAKFGVTVTHRDGWSRAERDGPLRVRRPFTQ
NILTKVEAAPWPYVPVDLLPIFIALGVRAEGSAMFWNKVYDGALGWSGELSKFGAHVLLS
DPHRLITFGGLQLTPARVESPYIIRVAIALLMVAASIEGRSEIMNALPIRRAHPHFVENL
RSVGANVEWTSGE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctcatcgtccacggcggcactccgctgcgcggggacatccagccgtccgcg
aacaagaacgccgtcctgccgattctgtgcgcgagcctgttgaccgatcagccgctgcgc
ctcgtcggcgtgccggacatcaccgacgtgcgcaagatcctcgacatcttccgcacgctc
ggcagcgacgtgtcggtcgatttcacgacgggcatcctcgagctccaccatcgcaacacc
acgttcgacccggccgttcaccgcctgcccgaggcgatgcgctcgtcgatcatgctgatt
ccgccgctgctcgcgcgcttcggcgtcgcgcgcctcgagaacgacgtgaaaggctgcacg
ctcggcgtgcgcgagatcgatccgcacgtcgaggtgttcgagcgcttcggcgcgcatatc
gagcgcacgcccgattcgctgatcgtccgtgccgacggcccgctgacggccaaccatcac
tggttcgactacgcgtcggtcaccaccaccgaaaacttcgcgctgtgcgcgactgcagca
agcggcacgtcgacgctgatgaatgcggcgtccgagccgcacgtgcaggagttctgccag
ttcctcgcgatgatcggcgtttcgatcgagggcatcggcacgtcgcgtctgtgcgtgacg
ggcggcggcaagctcggcggcggcgaattccgcttcgccgaggatttccacgaaatcgcg
acgttcctcgcgctcggcgcgatcacgggcggcgacatcaccgtgcgcaactcgtcgccg
gagcatttcccgctgatcgaccgcacgttcgcgaaattcggcgtgaccgtcacgcaccgc
gacggctggtcccgcgcggaacgcgacggcccgctgcgcgtgcgccggccgttcacgcag
aacatcctgaccaaggtcgaagccgcgccgtggccgtacgtgccggtcgacctgctgccg
atcttcatcgccctcggcgtgcgcgcggaaggcagcgcgatgttctggaacaaggtgtac
gacggcgcgctcggctggtccggcgaactgtcgaagttcggcgcgcacgtgctgctgtcg
gatccgcaccggctgatcacgttcggcgggctgcaactgacgccggcgcgcgtcgagagc
ccgtacatcatccgcgtcgcgatcgcgctgctgatggtggccgcgagcatcgaaggccgc
tcggaaatcatgaacgcgctgccgatccgccgcgcgcacccgcacttcgtcgaaaacctg
cgttcggtcggcgcgaacgtcgagtggacgagcggcgagtaa

DBGET integrated database retrieval system