KEGG   Burkholderia ambifaria MC40-6: BamMC406_4279Help
Entry
BamMC406_4279     CDS       T00684                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00071  Fatty acid degradation
bac00350  Tyrosine metabolism
bac00625  Chloroalkane and chloroalkene degradation
bac00626  Naphthalene degradation
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_4279
  Lipid metabolism
   00071 Fatty acid degradation
    BamMC406_4279
  Amino acid metabolism
   00350 Tyrosine metabolism
    BamMC406_4279
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BamMC406_4279
   00626 Naphthalene degradation
    BamMC406_4279
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BamMC406_4279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACB66742
JGI: BamMC4064279
UniProt: B1YWN0
Position
2:1336773..1337762
Genome map
AA seq 329 aa AA seqDB search
MLAMMFDGTTPHLREARMPGPSPAAGQLLIDVHACGVCRTDLHVVDGELAHPKLPLIPGH
EIVGTVRALGEGVTGFSVGDRVGVPWLGSTCGHCAYCTSGRENLCDSPGFTGYTIDGGYA
ERTVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGDARRIGIYGFGAAAHLVAQV
AHREGRKVFAFTKAGDTVAQQLALSLGAAWAGGSDEAPPEPLDAALIFAPVGALVPAALR
AVDKGGIVVCGGIHMSDIPAFPYAWLWGERRIASVANLTRADAVEFMRIADAMPLQVEAV
RYALTDANRALDDLRSGRVSGAAVLGMRG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgatgatgtttgacggcacgacaccgcatttgcgcgaagcgcgcatgccgggt
ccgtcgcccgctgccggtcagctcctgatcgacgtccatgcgtgcggcgtctgccgaacc
gatctgcacgtcgtcgacggcgaactcgcgcatccgaagctgccgctgattccggggcac
gaaatcgtcggaacggtgcgcgcgctcggcgagggcgtgacgggtttctccgtcggcgac
cgggtgggcgtaccgtggctcggctcgacctgcgggcattgcgcgtattgcacatcgggc
cgcgaaaacctgtgcgacagcccgggcttcaccggctatacgatcgacggtggctatgcc
gagcgcaccgtcgccgaccatcggtattgcgtgcatctgccgcggcgctattccgacctg
gaagccgctccgctactgtgcgccgggctgatcggttatcgaaccttgcgcatggcgggc
gacgctcgccggatcggaatctacggcttcggcgccgcggcccatctcgtcgcccaggtc
gcgcatcgcgaaggacgcaaggtgtttgcgttcacgaaggccggcgacaccgtggcgcag
cagctcgcgctatcgctgggcgccgcgtgggccggcggcagcgacgaagcgccgcccgag
ccgctcgatgccgcgctgatcttcgcgccggtcggtgcgctggtgccggccgcgctgcgg
gcggtcgacaagggcgggatcgtcgtatgcggcggcattcacatgagcgacatcccggcc
tttccgtacgcgtggctgtggggtgagcgccgtatcgcgtcggtggccaacctgacgcgt
gcggatgcagtcgaattcatgcggatcgcggacgcgatgccgctgcaggtcgaggccgtg
cgctatgcgctgaccgatgccaaccgcgcactcgacgacttgcgcagcgggcgcgtgtcg
ggcgccgccgtgctgggcatgcgcggttga

DBGET integrated database retrieval system